Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X0QD91

Protein Details
Accession A0A1X0QD91    Localization Confidence Low Confidence Score 5.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MGEVKKIKFKSKNVKKILLDHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 22, cyto_nucl 13, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR037177  DLC_sf  
IPR001372  Dynein_light_chain_typ-1/2  
Gene Ontology GO:0030286  C:dynein complex  
GO:0007017  P:microtubule-based process  
Pfam View protein in Pfam  
PF01221  Dynein_light  
Amino Acid Sequences MGEVKKIKFKSKNVKKILLDFVLEIFANFKEESLPERVNIIKDKLDEKFDGGWNVWCGKHITGVCTYITRTFIEFEHDEVFYTIYQTYTPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.77
3 0.76
4 0.72
5 0.63
6 0.53
7 0.43
8 0.36
9 0.28
10 0.24
11 0.17
12 0.11
13 0.09
14 0.1
15 0.09
16 0.08
17 0.08
18 0.08
19 0.11
20 0.15
21 0.16
22 0.14
23 0.16
24 0.17
25 0.18
26 0.2
27 0.19
28 0.16
29 0.17
30 0.19
31 0.18
32 0.2
33 0.18
34 0.17
35 0.18
36 0.17
37 0.17
38 0.15
39 0.16
40 0.15
41 0.16
42 0.14
43 0.13
44 0.14
45 0.13
46 0.17
47 0.16
48 0.17
49 0.17
50 0.19
51 0.19
52 0.18
53 0.19
54 0.16
55 0.17
56 0.16
57 0.15
58 0.15
59 0.14
60 0.19
61 0.19
62 0.19
63 0.2
64 0.19
65 0.19
66 0.18
67 0.19
68 0.13
69 0.13
70 0.11
71 0.09