Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X0Q8S4

Protein Details
Accession A0A1X0Q8S4    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
181-227AYKDAKAKAIKHKDKRYVADIDLEKDELQPKHTRKKKKKEKQQNLNWHydrophilic
NLS Segment(s)
PositionSequence
211-221KHTRKKKKKEK
Subcellular Location(s) nucl 23, mito_nucl 13.833, cyto_nucl 12.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR029004  L28e/Mak16  
IPR006958  Mak16  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF04874  Mak16  
PF01778  Ribosomal_L28e  
Amino Acid Sequences MLDRKIWESIGNKKTCSFKLNTKVETLCKNKYNVTGYCNEFSCPLANTKYATVRVVEDKLYLMIKEPERTHTPVEMYEKIELSYDYLEALKQLDENLEFWDPEVIHKCKQRLTKMFEYLERKLNLEENPLPQLTVRKTKMNRREKIRALKALNTLNFEKDISRELMIRLEEGIFGDELLEAYKDAKAKAIKHKDKRYVADIDLEKDELQPKHTRKKKKKEKQQNLNW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.5
3 0.51
4 0.46
5 0.47
6 0.53
7 0.6
8 0.58
9 0.57
10 0.57
11 0.57
12 0.6
13 0.57
14 0.54
15 0.5
16 0.51
17 0.49
18 0.52
19 0.53
20 0.46
21 0.45
22 0.44
23 0.44
24 0.44
25 0.41
26 0.35
27 0.3
28 0.28
29 0.25
30 0.19
31 0.19
32 0.18
33 0.18
34 0.19
35 0.21
36 0.25
37 0.25
38 0.24
39 0.21
40 0.22
41 0.24
42 0.24
43 0.22
44 0.18
45 0.17
46 0.17
47 0.17
48 0.14
49 0.12
50 0.16
51 0.17
52 0.22
53 0.22
54 0.26
55 0.3
56 0.32
57 0.32
58 0.29
59 0.28
60 0.27
61 0.31
62 0.28
63 0.26
64 0.25
65 0.23
66 0.21
67 0.2
68 0.16
69 0.12
70 0.1
71 0.08
72 0.07
73 0.07
74 0.07
75 0.06
76 0.07
77 0.06
78 0.05
79 0.05
80 0.06
81 0.06
82 0.07
83 0.09
84 0.09
85 0.09
86 0.09
87 0.1
88 0.09
89 0.11
90 0.16
91 0.16
92 0.19
93 0.23
94 0.25
95 0.28
96 0.34
97 0.4
98 0.42
99 0.47
100 0.5
101 0.52
102 0.52
103 0.53
104 0.53
105 0.47
106 0.46
107 0.39
108 0.33
109 0.28
110 0.29
111 0.24
112 0.24
113 0.23
114 0.19
115 0.2
116 0.2
117 0.19
118 0.16
119 0.2
120 0.18
121 0.24
122 0.25
123 0.3
124 0.36
125 0.45
126 0.55
127 0.61
128 0.66
129 0.66
130 0.73
131 0.74
132 0.79
133 0.77
134 0.75
135 0.67
136 0.65
137 0.62
138 0.59
139 0.52
140 0.45
141 0.39
142 0.32
143 0.3
144 0.25
145 0.2
146 0.15
147 0.16
148 0.14
149 0.14
150 0.14
151 0.13
152 0.16
153 0.16
154 0.15
155 0.14
156 0.12
157 0.11
158 0.11
159 0.11
160 0.07
161 0.07
162 0.06
163 0.06
164 0.05
165 0.06
166 0.06
167 0.05
168 0.06
169 0.08
170 0.09
171 0.09
172 0.15
173 0.19
174 0.25
175 0.36
176 0.46
177 0.55
178 0.64
179 0.74
180 0.79
181 0.83
182 0.82
183 0.77
184 0.71
185 0.62
186 0.61
187 0.53
188 0.47
189 0.41
190 0.36
191 0.31
192 0.27
193 0.32
194 0.24
195 0.26
196 0.32
197 0.38
198 0.47
199 0.56
200 0.65
201 0.69
202 0.8
203 0.87
204 0.89
205 0.93
206 0.94
207 0.97