Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X0QCU8

Protein Details
Accession A0A1X0QCU8   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
71-98PHEINNRIINRRRRKRWTRYIPCCLLRYHydrophilic
NLS Segment(s)
PositionSequence
81-86RRRRKR
Subcellular Location(s) nucl 16, mito_nucl 13.833, mito 10.5, cyto_nucl 8.833
Family & Domain DBs
Amino Acid Sequences MKVNQPITGNNLENSFGVTKLTGQKVSMLTNSSSRNQRRSALRPKPHRFPFDSKVIKGQTKGILFSAPVEPHEINNRIINRRRRKRWTRYIPCCLLRYTIDYLFYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.2
3 0.14
4 0.13
5 0.12
6 0.14
7 0.19
8 0.22
9 0.2
10 0.19
11 0.23
12 0.24
13 0.26
14 0.24
15 0.2
16 0.18
17 0.22
18 0.25
19 0.26
20 0.33
21 0.35
22 0.38
23 0.38
24 0.43
25 0.46
26 0.52
27 0.58
28 0.6
29 0.65
30 0.71
31 0.75
32 0.79
33 0.78
34 0.74
35 0.69
36 0.66
37 0.61
38 0.61
39 0.58
40 0.49
41 0.48
42 0.46
43 0.41
44 0.35
45 0.33
46 0.28
47 0.25
48 0.25
49 0.2
50 0.17
51 0.16
52 0.17
53 0.17
54 0.12
55 0.12
56 0.15
57 0.15
58 0.16
59 0.22
60 0.22
61 0.21
62 0.26
63 0.3
64 0.34
65 0.42
66 0.51
67 0.56
68 0.64
69 0.73
70 0.78
71 0.85
72 0.88
73 0.91
74 0.93
75 0.93
76 0.92
77 0.92
78 0.9
79 0.86
80 0.77
81 0.68
82 0.6
83 0.51
84 0.45
85 0.41
86 0.35