Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X0QAK2

Protein Details
Accession A0A1X0QAK2   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
69-89YKTSKFIPKELRRKLNKAKRLHydrophilic
NLS Segment(s)
PositionSequence
79-87LRRKLNKAK
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036049  Ribosomal_L29/L35_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Amino Acid Sequences MVQASELRKMNSEELKEHVKEQLYEKQKFLQQKHSKKVQPFDIRRVRKEITRTKQIQYEKKLEEFVEQYKTSKFIPKELRRKLNKAKRLALTDEQKNKMSRAMRYQNMKYPKKVYSFNPLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.41
3 0.39
4 0.37
5 0.36
6 0.32
7 0.31
8 0.34
9 0.38
10 0.39
11 0.41
12 0.41
13 0.42
14 0.44
15 0.49
16 0.48
17 0.5
18 0.52
19 0.6
20 0.67
21 0.71
22 0.72
23 0.7
24 0.73
25 0.72
26 0.72
27 0.68
28 0.7
29 0.7
30 0.7
31 0.67
32 0.66
33 0.58
34 0.51
35 0.55
36 0.55
37 0.52
38 0.56
39 0.57
40 0.53
41 0.58
42 0.61
43 0.59
44 0.55
45 0.54
46 0.47
47 0.44
48 0.43
49 0.37
50 0.32
51 0.26
52 0.23
53 0.21
54 0.19
55 0.19
56 0.18
57 0.19
58 0.18
59 0.23
60 0.21
61 0.24
62 0.35
63 0.43
64 0.53
65 0.61
66 0.7
67 0.7
68 0.78
69 0.81
70 0.81
71 0.79
72 0.77
73 0.75
74 0.71
75 0.69
76 0.67
77 0.64
78 0.62
79 0.62
80 0.63
81 0.59
82 0.57
83 0.54
84 0.49
85 0.48
86 0.44
87 0.41
88 0.43
89 0.49
90 0.52
91 0.59
92 0.63
93 0.65
94 0.71
95 0.71
96 0.68
97 0.64
98 0.64
99 0.61
100 0.62
101 0.58