Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X0Q675

Protein Details
Accession A0A1X0Q675   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
10-34LSVPHFEAKHKKKRIFRKEAGSFLRHydrophilic
NLS Segment(s)
PositionSequence
18-27KHKKKRIFRK
Subcellular Location(s) nucl 12mito 12mito_nucl 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR000592  Ribosomal_S27  
IPR023407  Ribosomal_S27_Zn-bd_dom_sf  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01667  Ribosomal_S27e  
Amino Acid Sequences MVYNFNASDLSVPHFEAKHKKKRIFRKEAGSFLRVTCNNCEETNITYSHSQSDIKCKGCYIPIMKCTGGRAVILNGSTFKKIDNRFY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.22
3 0.31
4 0.4
5 0.46
6 0.55
7 0.62
8 0.68
9 0.78
10 0.85
11 0.84
12 0.83
13 0.83
14 0.8
15 0.81
16 0.76
17 0.66
18 0.56
19 0.46
20 0.45
21 0.36
22 0.31
23 0.25
24 0.23
25 0.23
26 0.22
27 0.22
28 0.17
29 0.18
30 0.17
31 0.15
32 0.15
33 0.14
34 0.14
35 0.14
36 0.14
37 0.14
38 0.13
39 0.21
40 0.25
41 0.27
42 0.27
43 0.26
44 0.26
45 0.26
46 0.31
47 0.27
48 0.28
49 0.29
50 0.33
51 0.33
52 0.32
53 0.32
54 0.29
55 0.25
56 0.2
57 0.18
58 0.16
59 0.17
60 0.17
61 0.16
62 0.16
63 0.18
64 0.19
65 0.17
66 0.18
67 0.24