Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X0QHX7

Protein Details
Accession A0A1X0QHX7    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MNNKHYQPKTFTNKKVKIQKENEPFKTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 10, mito 8
Family & Domain DBs
Amino Acid Sequences MNNKHYQPKTFTNKKVKIQKENEPFKTKLGTINVETCINRLNSFPDTDNLEKLLKLKEESIEILKNELRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.84
3 0.83
4 0.83
5 0.79
6 0.8
7 0.79
8 0.81
9 0.79
10 0.75
11 0.67
12 0.58
13 0.54
14 0.44
15 0.39
16 0.32
17 0.28
18 0.23
19 0.25
20 0.25
21 0.24
22 0.23
23 0.19
24 0.18
25 0.15
26 0.14
27 0.12
28 0.13
29 0.13
30 0.15
31 0.16
32 0.16
33 0.21
34 0.22
35 0.22
36 0.21
37 0.21
38 0.19
39 0.2
40 0.22
41 0.18
42 0.18
43 0.2
44 0.19
45 0.21
46 0.24
47 0.27
48 0.27
49 0.26
50 0.28