Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X0QD60

Protein Details
Accession A0A1X0QD60   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
38-67SKVPLIKKRELRKTRPKYIKKRVIKKGVFLBasic
NLS Segment(s)
PositionSequence
43-64IKKRELRKTRPKYIKKRVIKKG
Subcellular Location(s) nucl 11, mito 10, cyto 5
Family & Domain DBs
Amino Acid Sequences MADNFTKTVIDVQPKISFTAQLILLHEKVYFSNKLESSKVPLIKKRELRKTRPKYIKKRVIKKGVFLRFKYCKSLFIYGTITKTKIHMKSSHFE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.35
3 0.3
4 0.27
5 0.21
6 0.23
7 0.2
8 0.17
9 0.19
10 0.19
11 0.19
12 0.18
13 0.17
14 0.14
15 0.13
16 0.16
17 0.15
18 0.14
19 0.19
20 0.2
21 0.23
22 0.24
23 0.24
24 0.27
25 0.3
26 0.34
27 0.32
28 0.36
29 0.39
30 0.44
31 0.51
32 0.53
33 0.59
34 0.61
35 0.67
36 0.73
37 0.77
38 0.8
39 0.83
40 0.85
41 0.85
42 0.88
43 0.89
44 0.88
45 0.89
46 0.88
47 0.88
48 0.8
49 0.78
50 0.77
51 0.76
52 0.73
53 0.65
54 0.64
55 0.6
56 0.6
57 0.6
58 0.51
59 0.47
60 0.45
61 0.49
62 0.41
63 0.38
64 0.41
65 0.35
66 0.39
67 0.36
68 0.32
69 0.27
70 0.3
71 0.34
72 0.34
73 0.37
74 0.4