Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X0Q8N7

Protein Details
Accession A0A1X0Q8N7    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
16-39VGTPSQPGEKKKRRKTDGLNSSIFHydrophilic
NLS Segment(s)
PositionSequence
23-30GEKKKRRK
89-90KK
Subcellular Location(s) nucl 21.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
Gene Ontology GO:0046982  F:protein heterodimerization activity  
Amino Acid Sequences MASPLKSTGKAPVKAVGTPSQPGEKKKRRKTDGLNSSIFRAPTKRMIRDSVGESHVTCTKQGLTVFCELAHKMLYMIGENLRELGHKGKKKTVGRREIETAVMLVFDGEMSRIMLREMRSTISKSQAKSANK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.43
3 0.39
4 0.33
5 0.32
6 0.33
7 0.35
8 0.36
9 0.42
10 0.49
11 0.54
12 0.62
13 0.7
14 0.78
15 0.77
16 0.83
17 0.86
18 0.86
19 0.86
20 0.82
21 0.77
22 0.67
23 0.64
24 0.56
25 0.46
26 0.36
27 0.28
28 0.24
29 0.28
30 0.34
31 0.35
32 0.36
33 0.39
34 0.4
35 0.41
36 0.41
37 0.36
38 0.31
39 0.27
40 0.24
41 0.22
42 0.23
43 0.2
44 0.16
45 0.13
46 0.12
47 0.14
48 0.15
49 0.14
50 0.13
51 0.14
52 0.14
53 0.14
54 0.14
55 0.12
56 0.11
57 0.1
58 0.08
59 0.06
60 0.07
61 0.07
62 0.06
63 0.07
64 0.08
65 0.08
66 0.08
67 0.08
68 0.07
69 0.07
70 0.08
71 0.15
72 0.21
73 0.26
74 0.29
75 0.35
76 0.44
77 0.52
78 0.61
79 0.64
80 0.67
81 0.66
82 0.68
83 0.67
84 0.6
85 0.53
86 0.43
87 0.33
88 0.23
89 0.18
90 0.13
91 0.07
92 0.05
93 0.04
94 0.04
95 0.04
96 0.04
97 0.05
98 0.06
99 0.06
100 0.07
101 0.11
102 0.12
103 0.16
104 0.17
105 0.2
106 0.23
107 0.27
108 0.31
109 0.37
110 0.4
111 0.38
112 0.45