Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X0QB53

Protein Details
Accession A0A1X0QB53   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
27-70QSLIWQRLPHYKRRRNRNYDKRHTKKVKPRKKDRHVLRTHTYFABasic
NLS Segment(s)
PositionSequence
33-61RLPHYKRRRNRNYDKRHTKKVKPRKKDRH
Subcellular Location(s) nucl 19.5, cyto_nucl 12, cyto 3.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR039182  Pop1  
IPR009723  Pop1_N  
Gene Ontology GO:0005655  C:nucleolar ribonuclease P complex  
GO:0000172  C:ribonuclease MRP complex  
GO:0001682  P:tRNA 5'-leader removal  
Pfam View protein in Pfam  
PF06978  POP1  
Amino Acid Sequences MIVDEFVNSRSKEIKEIEKSIETKKKQSLIWQRLPHYKRRRNRNYDKRHTKKVKPRKKDRHVLRTHTYFAKRFFMLKLKDKLSIPLNRRVKSDKFIYKFSLRLLVFDESFRGVFEYKRDEQTIEENSDLIVVGDKIISIGKQLNKELIDSKLCSFVLYGKDIDLNILKEDYYIKIIELNSLLEKYKIICYRNRAMKILNTLISNKYTALSLNELHRLSLENNIMTIYDNVQSDIYKQISLSQNDILIDKLNKTPKGKQSKTTILNLNEIYKDKEVSYFVFKVDKGTVSSYTNILAVNNIHIGHVIRSSFKFSSGSVYGLGVTDCNIEVNEILKFKNKQNHFYSGKIIKIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.44
3 0.49
4 0.52
5 0.54
6 0.56
7 0.59
8 0.63
9 0.58
10 0.58
11 0.6
12 0.6
13 0.56
14 0.63
15 0.64
16 0.65
17 0.71
18 0.71
19 0.7
20 0.75
21 0.77
22 0.77
23 0.77
24 0.77
25 0.76
26 0.79
27 0.84
28 0.84
29 0.92
30 0.92
31 0.92
32 0.94
33 0.96
34 0.93
35 0.93
36 0.92
37 0.91
38 0.91
39 0.91
40 0.91
41 0.9
42 0.93
43 0.93
44 0.94
45 0.94
46 0.94
47 0.94
48 0.93
49 0.9
50 0.87
51 0.82
52 0.76
53 0.73
54 0.68
55 0.61
56 0.55
57 0.52
58 0.44
59 0.4
60 0.39
61 0.4
62 0.41
63 0.46
64 0.49
65 0.47
66 0.5
67 0.49
68 0.5
69 0.49
70 0.5
71 0.46
72 0.49
73 0.54
74 0.52
75 0.55
76 0.56
77 0.53
78 0.5
79 0.55
80 0.54
81 0.49
82 0.51
83 0.53
84 0.5
85 0.48
86 0.43
87 0.42
88 0.33
89 0.3
90 0.3
91 0.26
92 0.23
93 0.22
94 0.22
95 0.14
96 0.14
97 0.13
98 0.11
99 0.09
100 0.1
101 0.12
102 0.18
103 0.2
104 0.24
105 0.25
106 0.24
107 0.25
108 0.29
109 0.3
110 0.25
111 0.23
112 0.19
113 0.18
114 0.17
115 0.16
116 0.1
117 0.06
118 0.04
119 0.04
120 0.04
121 0.04
122 0.04
123 0.04
124 0.04
125 0.05
126 0.09
127 0.12
128 0.15
129 0.16
130 0.19
131 0.19
132 0.2
133 0.21
134 0.19
135 0.19
136 0.18
137 0.18
138 0.18
139 0.17
140 0.16
141 0.14
142 0.15
143 0.15
144 0.15
145 0.15
146 0.12
147 0.13
148 0.12
149 0.13
150 0.11
151 0.09
152 0.08
153 0.08
154 0.08
155 0.07
156 0.08
157 0.08
158 0.08
159 0.07
160 0.07
161 0.1
162 0.1
163 0.1
164 0.1
165 0.1
166 0.09
167 0.09
168 0.1
169 0.07
170 0.07
171 0.08
172 0.13
173 0.16
174 0.18
175 0.21
176 0.26
177 0.34
178 0.42
179 0.43
180 0.39
181 0.37
182 0.38
183 0.39
184 0.37
185 0.31
186 0.24
187 0.23
188 0.23
189 0.22
190 0.2
191 0.15
192 0.12
193 0.11
194 0.1
195 0.1
196 0.11
197 0.11
198 0.13
199 0.18
200 0.17
201 0.17
202 0.17
203 0.17
204 0.15
205 0.19
206 0.18
207 0.13
208 0.13
209 0.13
210 0.13
211 0.12
212 0.12
213 0.09
214 0.09
215 0.09
216 0.1
217 0.1
218 0.1
219 0.11
220 0.14
221 0.13
222 0.11
223 0.11
224 0.17
225 0.23
226 0.24
227 0.25
228 0.22
229 0.23
230 0.23
231 0.24
232 0.17
233 0.14
234 0.14
235 0.14
236 0.18
237 0.23
238 0.27
239 0.31
240 0.38
241 0.45
242 0.55
243 0.57
244 0.58
245 0.61
246 0.67
247 0.67
248 0.66
249 0.65
250 0.56
251 0.57
252 0.51
253 0.45
254 0.38
255 0.35
256 0.32
257 0.25
258 0.24
259 0.19
260 0.2
261 0.19
262 0.19
263 0.24
264 0.22
265 0.22
266 0.24
267 0.24
268 0.25
269 0.25
270 0.24
271 0.2
272 0.22
273 0.23
274 0.22
275 0.24
276 0.21
277 0.2
278 0.19
279 0.17
280 0.14
281 0.13
282 0.11
283 0.11
284 0.13
285 0.12
286 0.11
287 0.12
288 0.13
289 0.13
290 0.15
291 0.14
292 0.16
293 0.17
294 0.23
295 0.22
296 0.23
297 0.23
298 0.21
299 0.27
300 0.25
301 0.25
302 0.19
303 0.19
304 0.18
305 0.17
306 0.17
307 0.1
308 0.09
309 0.09
310 0.08
311 0.08
312 0.08
313 0.08
314 0.08
315 0.1
316 0.13
317 0.13
318 0.14
319 0.21
320 0.25
321 0.32
322 0.41
323 0.46
324 0.51
325 0.56
326 0.65
327 0.62
328 0.62
329 0.64
330 0.6