Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X0Q9A5

Protein Details
Accession A0A1X0Q9A5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
385-404NEFGKKKYYKEKMNLKNQDDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 10.5, cyto_nucl 8, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027073  5_3_exoribonuclease  
IPR041412  Xrn1_helical  
IPR004859  Xrn1_N  
Gene Ontology GO:0004534  F:5'-3' RNA exonuclease activity  
GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF17846  XRN_M  
PF03159  XRN_N  
CDD cd18673  PIN_XRN1-2-like  
Amino Acid Sequences MGVPSLFKWLKIKYQGVTTKMLKGLDYNVDCLYLDFNAIIHPCTIKECNSLEDVDRKLYENIDIYLNNLIHSVYPRKLIYISVDGPAPAAKINQQRMRRFEGAKEVFNGNQYYLTEDVQLKDKERYNLIFDKNSITPGTKFMERLDNFIRTYIKYKMSTEEVWKRCTVIYSDHKVPGEGEQKIMEYIRIHQGHNYNKDYKHVIYSPDADLIFLGLTLQNHNVRIMREDEIKKVIETDNPTSELALETDFRNMKFIFVEINKMRNSMVDAFINDIGETFDSKRFIRDFIFLCFTVGNDFLPCSPAFEIRTNAIEKIRSIYVRSYKETKSYIVTDSLTINYKALIAFFRLCAAEEDANLEDKRDNLIRSRERMNRIFDEDVEFLLDNEFGKKKYYKEKMNLKNQDDLLSSCLMYVKGMEWICKYYFDNNCPSWNWYYPNYYAPFMKDLCMLDPDIVISFAKSVPCKAYETLLLALPSVSMHLLPERLRKFYFDNESIKLKSPYCDKIDLKSDKGDFKYDYIEIYNSLDTXXXXIYAFIT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.57
3 0.56
4 0.6
5 0.54
6 0.52
7 0.5
8 0.48
9 0.38
10 0.33
11 0.34
12 0.35
13 0.34
14 0.3
15 0.27
16 0.27
17 0.27
18 0.25
19 0.22
20 0.13
21 0.12
22 0.09
23 0.08
24 0.11
25 0.12
26 0.12
27 0.12
28 0.12
29 0.12
30 0.18
31 0.2
32 0.2
33 0.25
34 0.25
35 0.27
36 0.29
37 0.3
38 0.29
39 0.32
40 0.32
41 0.3
42 0.3
43 0.3
44 0.29
45 0.28
46 0.27
47 0.23
48 0.22
49 0.21
50 0.2
51 0.19
52 0.23
53 0.22
54 0.19
55 0.17
56 0.15
57 0.13
58 0.18
59 0.22
60 0.18
61 0.24
62 0.24
63 0.25
64 0.25
65 0.26
66 0.26
67 0.28
68 0.27
69 0.24
70 0.24
71 0.22
72 0.22
73 0.21
74 0.16
75 0.1
76 0.09
77 0.15
78 0.22
79 0.31
80 0.39
81 0.47
82 0.53
83 0.58
84 0.65
85 0.65
86 0.6
87 0.55
88 0.58
89 0.54
90 0.49
91 0.47
92 0.42
93 0.36
94 0.37
95 0.34
96 0.23
97 0.21
98 0.19
99 0.18
100 0.17
101 0.17
102 0.17
103 0.17
104 0.18
105 0.22
106 0.24
107 0.23
108 0.28
109 0.32
110 0.32
111 0.35
112 0.36
113 0.36
114 0.42
115 0.44
116 0.41
117 0.37
118 0.38
119 0.34
120 0.34
121 0.29
122 0.24
123 0.2
124 0.21
125 0.24
126 0.21
127 0.21
128 0.21
129 0.3
130 0.28
131 0.33
132 0.33
133 0.33
134 0.32
135 0.34
136 0.34
137 0.25
138 0.29
139 0.28
140 0.3
141 0.28
142 0.3
143 0.31
144 0.33
145 0.34
146 0.39
147 0.44
148 0.42
149 0.43
150 0.42
151 0.39
152 0.35
153 0.34
154 0.27
155 0.25
156 0.3
157 0.34
158 0.38
159 0.4
160 0.4
161 0.38
162 0.37
163 0.35
164 0.33
165 0.27
166 0.24
167 0.2
168 0.21
169 0.21
170 0.21
171 0.16
172 0.1
173 0.12
174 0.2
175 0.21
176 0.21
177 0.24
178 0.31
179 0.37
180 0.43
181 0.45
182 0.42
183 0.41
184 0.44
185 0.43
186 0.37
187 0.35
188 0.3
189 0.28
190 0.25
191 0.27
192 0.25
193 0.24
194 0.23
195 0.18
196 0.16
197 0.13
198 0.1
199 0.07
200 0.06
201 0.04
202 0.05
203 0.06
204 0.09
205 0.1
206 0.1
207 0.12
208 0.13
209 0.13
210 0.15
211 0.16
212 0.16
213 0.22
214 0.23
215 0.24
216 0.25
217 0.25
218 0.23
219 0.23
220 0.21
221 0.17
222 0.2
223 0.21
224 0.2
225 0.21
226 0.21
227 0.19
228 0.19
229 0.15
230 0.11
231 0.09
232 0.08
233 0.06
234 0.1
235 0.11
236 0.11
237 0.13
238 0.13
239 0.12
240 0.12
241 0.11
242 0.12
243 0.11
244 0.18
245 0.17
246 0.21
247 0.21
248 0.21
249 0.21
250 0.17
251 0.19
252 0.14
253 0.15
254 0.11
255 0.11
256 0.12
257 0.13
258 0.12
259 0.09
260 0.08
261 0.06
262 0.06
263 0.07
264 0.07
265 0.08
266 0.1
267 0.1
268 0.13
269 0.13
270 0.14
271 0.15
272 0.18
273 0.18
274 0.19
275 0.22
276 0.19
277 0.19
278 0.18
279 0.16
280 0.13
281 0.12
282 0.09
283 0.06
284 0.06
285 0.06
286 0.08
287 0.08
288 0.08
289 0.09
290 0.1
291 0.13
292 0.15
293 0.16
294 0.16
295 0.19
296 0.18
297 0.19
298 0.18
299 0.17
300 0.15
301 0.16
302 0.17
303 0.15
304 0.16
305 0.2
306 0.26
307 0.29
308 0.32
309 0.34
310 0.33
311 0.37
312 0.38
313 0.34
314 0.29
315 0.28
316 0.26
317 0.23
318 0.22
319 0.19
320 0.18
321 0.18
322 0.17
323 0.15
324 0.13
325 0.11
326 0.11
327 0.1
328 0.09
329 0.08
330 0.08
331 0.09
332 0.09
333 0.1
334 0.1
335 0.1
336 0.11
337 0.14
338 0.12
339 0.11
340 0.14
341 0.13
342 0.16
343 0.15
344 0.15
345 0.12
346 0.12
347 0.15
348 0.15
349 0.16
350 0.18
351 0.28
352 0.32
353 0.36
354 0.44
355 0.48
356 0.52
357 0.56
358 0.57
359 0.52
360 0.52
361 0.49
362 0.42
363 0.39
364 0.33
365 0.27
366 0.23
367 0.19
368 0.13
369 0.12
370 0.12
371 0.07
372 0.1
373 0.11
374 0.1
375 0.15
376 0.17
377 0.22
378 0.32
379 0.41
380 0.47
381 0.55
382 0.66
383 0.72
384 0.8
385 0.84
386 0.77
387 0.75
388 0.67
389 0.6
390 0.51
391 0.42
392 0.33
393 0.25
394 0.22
395 0.15
396 0.15
397 0.12
398 0.1
399 0.1
400 0.08
401 0.13
402 0.14
403 0.16
404 0.16
405 0.19
406 0.2
407 0.22
408 0.23
409 0.26
410 0.31
411 0.33
412 0.39
413 0.38
414 0.41
415 0.41
416 0.43
417 0.39
418 0.37
419 0.37
420 0.33
421 0.36
422 0.35
423 0.39
424 0.38
425 0.36
426 0.34
427 0.32
428 0.33
429 0.28
430 0.27
431 0.24
432 0.22
433 0.22
434 0.22
435 0.2
436 0.16
437 0.15
438 0.15
439 0.12
440 0.12
441 0.1
442 0.08
443 0.08
444 0.09
445 0.13
446 0.13
447 0.15
448 0.18
449 0.2
450 0.23
451 0.23
452 0.25
453 0.24
454 0.27
455 0.26
456 0.25
457 0.23
458 0.19
459 0.18
460 0.15
461 0.12
462 0.09
463 0.08
464 0.06
465 0.07
466 0.09
467 0.13
468 0.16
469 0.26
470 0.28
471 0.32
472 0.33
473 0.36
474 0.38
475 0.43
476 0.49
477 0.47
478 0.49
479 0.49
480 0.53
481 0.52
482 0.53
483 0.49
484 0.42
485 0.4
486 0.42
487 0.45
488 0.45
489 0.51
490 0.48
491 0.51
492 0.59
493 0.6
494 0.57
495 0.57
496 0.56
497 0.55
498 0.55
499 0.53
500 0.45
501 0.42
502 0.43
503 0.36
504 0.33
505 0.28
506 0.27
507 0.23
508 0.24
509 0.22
510 0.17
511 0.16
512 0.14
513 0.12