Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X0Q6V4

Protein Details
Accession A0A1X0Q6V4    Localization Confidence High Confidence Score 16.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-26KENLISFKKLKKSKNKDKIGLNEESHydrophilic
70-92NEKEKFIKKKELKRFYKSKESKVBasic
NLS Segment(s)
PositionSequence
11-16LKKSKN
76-83IKKKELKR
Subcellular Location(s) nucl 16, cyto_nucl 10.5, mito 8
Family & Domain DBs
Amino Acid Sequences MKENLISFKKLKKSKNKDKIGLNEESKIIKTNKLEINHQTINMKIKKYCDQLECRYKKSAVKQEQFEKFNEKEKFIKKKELKRFYKSKESKVIENENNFYKSLSNEYKEIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.85
3 0.87
4 0.85
5 0.86
6 0.86
7 0.81
8 0.78
9 0.69
10 0.61
11 0.53
12 0.46
13 0.38
14 0.33
15 0.29
16 0.25
17 0.24
18 0.29
19 0.33
20 0.34
21 0.38
22 0.37
23 0.43
24 0.4
25 0.4
26 0.33
27 0.29
28 0.35
29 0.33
30 0.31
31 0.25
32 0.28
33 0.33
34 0.36
35 0.39
36 0.37
37 0.4
38 0.47
39 0.56
40 0.55
41 0.52
42 0.5
43 0.47
44 0.45
45 0.47
46 0.49
47 0.48
48 0.51
49 0.53
50 0.59
51 0.64
52 0.62
53 0.55
54 0.51
55 0.43
56 0.46
57 0.42
58 0.37
59 0.37
60 0.44
61 0.52
62 0.5
63 0.59
64 0.59
65 0.67
66 0.75
67 0.79
68 0.79
69 0.78
70 0.84
71 0.81
72 0.84
73 0.8
74 0.78
75 0.78
76 0.73
77 0.7
78 0.68
79 0.7
80 0.66
81 0.64
82 0.6
83 0.55
84 0.53
85 0.46
86 0.39
87 0.31
88 0.26
89 0.29
90 0.32
91 0.3