Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X0Q887

Protein Details
Accession A0A1X0Q887    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MKGKASNKKKISKKYGVRYGSRHydrophilic
NLS Segment(s)
PositionSequence
4-15KASNKKKISKKY
Subcellular Location(s) mito 13, cyto 9, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR002674  Ribosomal_L37ae  
IPR011331  Ribosomal_L37ae/L37e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01780  Ribosomal_L37ae  
Amino Acid Sequences MKGKASNKKKISKKYGVRYGSRLRKIVNTIEVMQKAKYVCEACGKKAVKRQVVGIWKCKICKHTFAGAAYGPRSTKLGSEAMRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.86
3 0.84
4 0.79
5 0.76
6 0.76
7 0.76
8 0.71
9 0.63
10 0.55
11 0.53
12 0.52
13 0.48
14 0.42
15 0.35
16 0.31
17 0.33
18 0.34
19 0.3
20 0.26
21 0.24
22 0.2
23 0.17
24 0.18
25 0.14
26 0.13
27 0.21
28 0.22
29 0.21
30 0.3
31 0.31
32 0.31
33 0.36
34 0.43
35 0.39
36 0.38
37 0.4
38 0.38
39 0.47
40 0.47
41 0.48
42 0.46
43 0.44
44 0.46
45 0.46
46 0.46
47 0.4
48 0.42
49 0.4
50 0.41
51 0.43
52 0.42
53 0.43
54 0.39
55 0.38
56 0.33
57 0.3
58 0.23
59 0.2
60 0.2
61 0.17
62 0.16
63 0.17
64 0.23