Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X0QDB7

Protein Details
Accession A0A1X0QDB7    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
47-72QVVRKEIKKTKLKKDIKTYLKKPITSHydrophilic
NLS Segment(s)
PositionSequence
54-59KKTKLK
Subcellular Location(s) nucl 18.5, cyto_nucl 13, cyto 4.5, mito 4
Family & Domain DBs
Amino Acid Sequences MQMNNIFIMIISYLQCGTDIEKNETRDISDLKRRFSEECRIIESVLQVVRKEIKKTKLKKDIKTYLKKPITSLIVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.1
5 0.14
6 0.17
7 0.22
8 0.27
9 0.29
10 0.3
11 0.3
12 0.28
13 0.25
14 0.25
15 0.24
16 0.29
17 0.3
18 0.31
19 0.33
20 0.34
21 0.34
22 0.35
23 0.39
24 0.35
25 0.34
26 0.35
27 0.33
28 0.31
29 0.3
30 0.26
31 0.19
32 0.16
33 0.15
34 0.11
35 0.13
36 0.19
37 0.21
38 0.26
39 0.31
40 0.38
41 0.46
42 0.55
43 0.65
44 0.69
45 0.76
46 0.79
47 0.83
48 0.84
49 0.85
50 0.87
51 0.82
52 0.82
53 0.81
54 0.73
55 0.65
56 0.62