Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X0QE08

Protein Details
Accession A0A1X0QE08    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
18-48SDRSRIKQSPHHKEKLKKRGRKPKNLLSGSNBasic
NLS Segment(s)
PositionSequence
18-41SDRSRIKQSPHHKEKLKKRGRKPK
Subcellular Location(s) nucl 19.5, mito_nucl 12.5, mito 4.5
Family & Domain DBs
Amino Acid Sequences MDIMIRDQKNKEKIAASSDRSRIKQSPHHKEKLKKRGRKPKNLLSGSNQGFQSIFKKKVDFDMTPEKWNALFDFKPVVLTQPKLGDHIKARIINHKNKENKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.5
3 0.47
4 0.48
5 0.52
6 0.54
7 0.52
8 0.55
9 0.51
10 0.5
11 0.54
12 0.57
13 0.61
14 0.64
15 0.71
16 0.73
17 0.79
18 0.83
19 0.85
20 0.85
21 0.83
22 0.84
23 0.86
24 0.89
25 0.9
26 0.89
27 0.87
28 0.87
29 0.82
30 0.74
31 0.69
32 0.67
33 0.58
34 0.52
35 0.43
36 0.32
37 0.28
38 0.25
39 0.25
40 0.21
41 0.22
42 0.19
43 0.2
44 0.2
45 0.27
46 0.31
47 0.27
48 0.28
49 0.35
50 0.36
51 0.38
52 0.38
53 0.32
54 0.27
55 0.27
56 0.23
57 0.17
58 0.15
59 0.14
60 0.17
61 0.16
62 0.18
63 0.17
64 0.2
65 0.19
66 0.2
67 0.22
68 0.24
69 0.24
70 0.27
71 0.28
72 0.29
73 0.29
74 0.33
75 0.37
76 0.36
77 0.38
78 0.45
79 0.52
80 0.57
81 0.61
82 0.65