Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X0Q9G0

Protein Details
Accession A0A1X0Q9G0    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-21VLGYRKKKEEVKKIVPKEVAHydrophilic
NLS Segment(s)
PositionSequence
6-26RKKKEEVKKIVPKEVAERRLK
Subcellular Location(s) nucl 22, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR029064  L30e-like  
Amino Acid Sequences MVLGYRKKKEEVKKIVPKEVAERRLKTKIEKLSTSIKIPAPIHQFNTKLSEKDEERVLSLLSKYSPETRKEKFERVKKEKETLSNMSEEKKTDIIKSADISDEIXXXXRNFYEIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.81
3 0.77
4 0.69
5 0.67
6 0.66
7 0.64
8 0.61
9 0.59
10 0.57
11 0.6
12 0.61
13 0.57
14 0.56
15 0.56
16 0.54
17 0.52
18 0.5
19 0.51
20 0.51
21 0.48
22 0.44
23 0.36
24 0.35
25 0.34
26 0.36
27 0.34
28 0.33
29 0.34
30 0.34
31 0.34
32 0.3
33 0.35
34 0.31
35 0.25
36 0.24
37 0.26
38 0.23
39 0.24
40 0.25
41 0.19
42 0.18
43 0.18
44 0.16
45 0.12
46 0.11
47 0.1
48 0.08
49 0.08
50 0.09
51 0.15
52 0.2
53 0.23
54 0.29
55 0.31
56 0.41
57 0.45
58 0.53
59 0.56
60 0.6
61 0.67
62 0.69
63 0.76
64 0.72
65 0.74
66 0.7
67 0.68
68 0.66
69 0.6
70 0.54
71 0.49
72 0.45
73 0.41
74 0.38
75 0.32
76 0.28
77 0.27
78 0.26
79 0.23
80 0.28
81 0.26
82 0.27
83 0.28
84 0.27
85 0.25
86 0.24
87 0.25
88 0.24
89 0.24
90 0.23
91 0.23