Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I4YF68

Protein Details
Accession I4YF68   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
39-62DVKRIERQKKSKEKEKKELENLGRBasic
NLS Segment(s)
PositionSequence
42-55RIERQKKSKEKEKK
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR039780  Mot2  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0030014  C:CCR4-NOT complex  
GO:0004842  F:ubiquitin-protein transferase activity  
KEGG wse:WALSEDRAFT_9653  -  
Pfam View protein in Pfam  
PF14570  zf-RING_4  
Amino Acid Sequences KICRFCWHHIKENLNRKCPACRREYTNEGAKFQPVAAEDVKRIERQKKSKEKEKKELENLGRTRLADVRVIQRSLAYIVGWPQSFTEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.73
3 0.66
4 0.68
5 0.67
6 0.64
7 0.61
8 0.57
9 0.58
10 0.62
11 0.65
12 0.61
13 0.61
14 0.57
15 0.52
16 0.47
17 0.4
18 0.32
19 0.27
20 0.22
21 0.14
22 0.14
23 0.13
24 0.13
25 0.12
26 0.15
27 0.17
28 0.18
29 0.21
30 0.25
31 0.31
32 0.39
33 0.49
34 0.57
35 0.63
36 0.7
37 0.78
38 0.8
39 0.82
40 0.83
41 0.82
42 0.78
43 0.8
44 0.75
45 0.74
46 0.66
47 0.6
48 0.52
49 0.43
50 0.38
51 0.32
52 0.28
53 0.22
54 0.24
55 0.28
56 0.31
57 0.31
58 0.29
59 0.26
60 0.26
61 0.24
62 0.21
63 0.13
64 0.1
65 0.13
66 0.17
67 0.17
68 0.17