Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I4YCH8

Protein Details
Accession I4YCH8    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
38-59FAPYQRTPQPKQKQDQRQGTIEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 8, cyto_nucl 8, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR039722  Upf3  
IPR005120  UPF3_dom  
Gene Ontology GO:0000184  P:nuclear-transcribed mRNA catabolic process, nonsense-mediated decay  
KEGG wse:WALSEDRAFT_11010  -  
Pfam View protein in Pfam  
PF03467  Smg4_UPF3  
Amino Acid Sequences SKENIASRAYITFKEYAQLLSFHAGFDGHLESRASIEFAPYQRTPQPKQKQDQRQGTIEEGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.19
3 0.17
4 0.16
5 0.15
6 0.13
7 0.14
8 0.14
9 0.12
10 0.11
11 0.1
12 0.08
13 0.09
14 0.09
15 0.07
16 0.07
17 0.08
18 0.07
19 0.08
20 0.08
21 0.08
22 0.06
23 0.07
24 0.09
25 0.1
26 0.16
27 0.15
28 0.19
29 0.23
30 0.3
31 0.34
32 0.42
33 0.52
34 0.55
35 0.65
36 0.72
37 0.79
38 0.83
39 0.88
40 0.83
41 0.78
42 0.73