Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1V6VUL4

Protein Details
Accession A0A1V6VUL4    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
74-95FRKPGRPQRKGAKESPRRKQAIBasic
NLS Segment(s)
PositionSequence
75-117RKPGRPQRKGAKESPRRKQAISEREAARLDWMRRLRPKPHRRY
Subcellular Location(s) mito 18.5, mito_nucl 13.333, nucl 7, cyto_nucl 4.333
Family & Domain DBs
Amino Acid Sequences MTPTARRPRRQRLASDYDLMPLLCDSSNLLPSKMITRRAGRNIGTDSSSPPSQRAKKILEMRIHHRFDGSHVTFRKPGRPQRKGAKESPRRKQAISEREAARLDWMRRLRPKPHRRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.72
3 0.61
4 0.51
5 0.45
6 0.36
7 0.27
8 0.18
9 0.14
10 0.09
11 0.08
12 0.09
13 0.1
14 0.15
15 0.15
16 0.16
17 0.15
18 0.16
19 0.23
20 0.25
21 0.28
22 0.28
23 0.33
24 0.39
25 0.44
26 0.49
27 0.43
28 0.43
29 0.41
30 0.37
31 0.34
32 0.28
33 0.24
34 0.23
35 0.23
36 0.19
37 0.18
38 0.24
39 0.27
40 0.3
41 0.33
42 0.33
43 0.39
44 0.46
45 0.5
46 0.49
47 0.48
48 0.51
49 0.55
50 0.54
51 0.46
52 0.39
53 0.33
54 0.28
55 0.35
56 0.3
57 0.28
58 0.28
59 0.3
60 0.35
61 0.36
62 0.41
63 0.39
64 0.47
65 0.51
66 0.56
67 0.62
68 0.68
69 0.77
70 0.76
71 0.77
72 0.78
73 0.77
74 0.81
75 0.83
76 0.82
77 0.75
78 0.7
79 0.71
80 0.7
81 0.69
82 0.63
83 0.62
84 0.54
85 0.55
86 0.55
87 0.46
88 0.42
89 0.39
90 0.36
91 0.36
92 0.39
93 0.44
94 0.52
95 0.59
96 0.63
97 0.68