Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V6Y7N1

Protein Details
Accession A0A1V6Y7N1   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
58-97GEAGRRLSRNHGKRRRRRPPDTLHRRERNRRKDRADAGGWBasic
NLS Segment(s)
PositionSequence
60-92AGRRLSRNHGKRRRRRPPDTLHRRERNRRKDRA
Subcellular Location(s) mito 18, nucl 4, cyto 3
Family & Domain DBs
Amino Acid Sequences MNRLVKETALRLQIGSAFAVPPTIYDVDPGWLDTDGGAGLEDRRAPYGSPEHIGERMGEAGRRLSRNHGKRRRRRPPDTLHRRERNRRKDRADAGGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.19
3 0.14
4 0.11
5 0.1
6 0.11
7 0.09
8 0.07
9 0.1
10 0.1
11 0.1
12 0.11
13 0.11
14 0.12
15 0.12
16 0.12
17 0.1
18 0.08
19 0.08
20 0.07
21 0.07
22 0.05
23 0.05
24 0.04
25 0.04
26 0.04
27 0.05
28 0.05
29 0.06
30 0.07
31 0.07
32 0.07
33 0.1
34 0.13
35 0.14
36 0.15
37 0.15
38 0.16
39 0.16
40 0.16
41 0.14
42 0.11
43 0.11
44 0.1
45 0.09
46 0.09
47 0.12
48 0.15
49 0.17
50 0.17
51 0.25
52 0.34
53 0.43
54 0.54
55 0.61
56 0.68
57 0.77
58 0.87
59 0.9
60 0.91
61 0.9
62 0.9
63 0.9
64 0.91
65 0.92
66 0.91
67 0.9
68 0.9
69 0.91
70 0.92
71 0.92
72 0.92
73 0.91
74 0.91
75 0.88
76 0.88
77 0.85