Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1V6VMT9

Protein Details
Accession A0A1V6VMT9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
9-35SKDVVSKRKLMRQKQCRRKTSLMKKACHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 10.5, cyto_nucl 7.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
Amino Acid Sequences MAAVKATRSKDVVSKRKLMRQKQCRRKTSLMKKACEYSRMCSADVCVGIRIRETG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.56
3 0.63
4 0.7
5 0.72
6 0.73
7 0.74
8 0.8
9 0.82
10 0.87
11 0.85
12 0.84
13 0.83
14 0.82
15 0.82
16 0.82
17 0.78
18 0.72
19 0.68
20 0.67
21 0.6
22 0.56
23 0.47
24 0.41
25 0.43
26 0.41
27 0.38
28 0.32
29 0.32
30 0.3
31 0.29
32 0.25
33 0.19
34 0.18
35 0.19