Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V6Z0D5

Protein Details
Accession A0A1V6Z0D5   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
4-36EGTYKHQSKAKGHKKARRHHRGGQKVRGPPPRLBasic
NLS Segment(s)
PositionSequence
11-34SKAKGHKKARRHHRGGQKVRGPPP
Subcellular Location(s) mito 23, nucl 3
Family & Domain DBs
Amino Acid Sequences MAMEGTYKHQSKAKGHKKARRHHRGGQKVRGPPPRLNFLLLLLLHHLLPLRRPLAPATSWTANINATAQGSPGVEPDLLSRLVQVSQSEAELLVRFPGKIREGSACEDFVENPLVEDEPGQESTQGPC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.7
3 0.76
4 0.82
5 0.86
6 0.88
7 0.88
8 0.85
9 0.84
10 0.85
11 0.87
12 0.87
13 0.87
14 0.84
15 0.81
16 0.82
17 0.81
18 0.75
19 0.71
20 0.66
21 0.63
22 0.56
23 0.5
24 0.41
25 0.33
26 0.33
27 0.26
28 0.21
29 0.15
30 0.14
31 0.12
32 0.12
33 0.12
34 0.07
35 0.09
36 0.12
37 0.12
38 0.12
39 0.13
40 0.14
41 0.16
42 0.17
43 0.17
44 0.18
45 0.18
46 0.18
47 0.18
48 0.17
49 0.14
50 0.14
51 0.12
52 0.08
53 0.08
54 0.07
55 0.06
56 0.06
57 0.06
58 0.06
59 0.06
60 0.06
61 0.06
62 0.06
63 0.06
64 0.08
65 0.08
66 0.08
67 0.08
68 0.08
69 0.08
70 0.09
71 0.08
72 0.08
73 0.08
74 0.09
75 0.09
76 0.08
77 0.08
78 0.08
79 0.08
80 0.08
81 0.08
82 0.08
83 0.09
84 0.14
85 0.15
86 0.16
87 0.18
88 0.22
89 0.24
90 0.29
91 0.3
92 0.26
93 0.25
94 0.25
95 0.23
96 0.19
97 0.19
98 0.14
99 0.13
100 0.13
101 0.13
102 0.12
103 0.12
104 0.12
105 0.12
106 0.14
107 0.14
108 0.14