Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V6YWZ0

Protein Details
Accession A0A1V6YWZ0    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
372-393LQKEAKSKPRKEDDWRERRDRNBasic
NLS Segment(s)
PositionSequence
376-408AKSKPRKEDDWRERRDRNLEKSGRDKDRDREYR
421-431RRKTGSSRRDR
Subcellular Location(s) cyto 8.5, cyto_nucl 8, nucl 6.5, mito 6, pero 2, plas 1, E.R. 1, cysk 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR000467  G_patch_dom  
IPR045166  Spp2-like  
IPR026822  Spp2/MOS2_G-patch  
Gene Ontology GO:0016020  C:membrane  
GO:0005681  C:spliceosomal complex  
GO:0003676  F:nucleic acid binding  
GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF12656  G-patch_2  
PROSITE View protein in PROSITE  
PS50174  G_PATCH  
Amino Acid Sequences MSSRDHNEGGKTPSKPISLSLSSSNGPPKKTGFNLQSSNRGRSTNSPANGRSLPRRPHQLGHADDSDEDEAPPAHEEISGFDTHTGAAIAADGQAVEDANKPLIIPVTSKNNWRDRAGVNVKKSKKNLLPAEVQAMQEAQKNGQAHPGEPTVETDTPSMAYGLSFAQQSAEKGDSAAAVVEDQAMPDAKPVETKPLTDDQIAMQALIRETKGDVERRSDLVIESATKEEEPVHYSELGSFRTDVASRPEPANLDAYNVIPVEEFGAALLRGMGWKDGQPIGRGNYSSATAAERAKNPRVPERRPGFLGIGAKDASGGKGAEAELGAWGKSAMRKASRKQGEENDKAEGVYMPIAMRNKKTGEHLTEEELAALQKEAKSKPRKEDDWRERRDRNLEKSGRDKDRDREYRRRDYDDEEEDRSRRKTGSSRRDRKAGGTTVPIGIETMTGIVAGTVMMIGMIEGEMEIESGTGTAAIDLEMRDTAAHGTRLGLTETETVIVIVIATLVGVVVMVRPDVLARRIEEY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.41
3 0.39
4 0.4
5 0.36
6 0.37
7 0.36
8 0.35
9 0.33
10 0.36
11 0.43
12 0.38
13 0.37
14 0.37
15 0.37
16 0.4
17 0.44
18 0.5
19 0.47
20 0.52
21 0.58
22 0.6
23 0.66
24 0.64
25 0.65
26 0.58
27 0.53
28 0.48
29 0.46
30 0.51
31 0.5
32 0.49
33 0.51
34 0.49
35 0.54
36 0.55
37 0.54
38 0.53
39 0.54
40 0.56
41 0.56
42 0.65
43 0.63
44 0.63
45 0.66
46 0.66
47 0.61
48 0.6
49 0.56
50 0.47
51 0.42
52 0.41
53 0.35
54 0.26
55 0.21
56 0.15
57 0.13
58 0.13
59 0.14
60 0.11
61 0.09
62 0.1
63 0.1
64 0.11
65 0.15
66 0.14
67 0.13
68 0.13
69 0.13
70 0.12
71 0.12
72 0.1
73 0.06
74 0.06
75 0.05
76 0.05
77 0.05
78 0.05
79 0.04
80 0.04
81 0.04
82 0.04
83 0.05
84 0.07
85 0.08
86 0.09
87 0.09
88 0.09
89 0.1
90 0.12
91 0.12
92 0.12
93 0.15
94 0.24
95 0.26
96 0.33
97 0.4
98 0.46
99 0.49
100 0.49
101 0.5
102 0.42
103 0.51
104 0.54
105 0.53
106 0.54
107 0.59
108 0.64
109 0.66
110 0.68
111 0.66
112 0.61
113 0.64
114 0.63
115 0.59
116 0.58
117 0.53
118 0.56
119 0.49
120 0.43
121 0.34
122 0.27
123 0.23
124 0.21
125 0.2
126 0.15
127 0.16
128 0.17
129 0.17
130 0.23
131 0.23
132 0.2
133 0.22
134 0.23
135 0.2
136 0.19
137 0.21
138 0.2
139 0.2
140 0.2
141 0.17
142 0.16
143 0.15
144 0.15
145 0.13
146 0.07
147 0.06
148 0.06
149 0.06
150 0.07
151 0.07
152 0.06
153 0.08
154 0.08
155 0.09
156 0.11
157 0.11
158 0.1
159 0.1
160 0.11
161 0.09
162 0.08
163 0.08
164 0.05
165 0.04
166 0.04
167 0.05
168 0.05
169 0.04
170 0.05
171 0.05
172 0.05
173 0.06
174 0.07
175 0.07
176 0.09
177 0.1
178 0.17
179 0.18
180 0.18
181 0.21
182 0.24
183 0.26
184 0.24
185 0.25
186 0.17
187 0.21
188 0.2
189 0.16
190 0.12
191 0.11
192 0.11
193 0.11
194 0.11
195 0.07
196 0.07
197 0.1
198 0.14
199 0.18
200 0.19
201 0.22
202 0.24
203 0.25
204 0.25
205 0.22
206 0.19
207 0.15
208 0.14
209 0.11
210 0.1
211 0.1
212 0.09
213 0.09
214 0.09
215 0.08
216 0.09
217 0.1
218 0.1
219 0.11
220 0.11
221 0.11
222 0.13
223 0.14
224 0.14
225 0.12
226 0.11
227 0.1
228 0.11
229 0.11
230 0.1
231 0.14
232 0.16
233 0.17
234 0.17
235 0.18
236 0.17
237 0.18
238 0.19
239 0.13
240 0.12
241 0.12
242 0.11
243 0.11
244 0.1
245 0.09
246 0.06
247 0.06
248 0.06
249 0.05
250 0.05
251 0.04
252 0.04
253 0.04
254 0.04
255 0.04
256 0.03
257 0.03
258 0.03
259 0.04
260 0.04
261 0.05
262 0.07
263 0.1
264 0.11
265 0.12
266 0.14
267 0.16
268 0.17
269 0.17
270 0.15
271 0.14
272 0.14
273 0.12
274 0.11
275 0.1
276 0.1
277 0.12
278 0.14
279 0.18
280 0.21
281 0.25
282 0.28
283 0.29
284 0.37
285 0.43
286 0.44
287 0.5
288 0.5
289 0.49
290 0.48
291 0.48
292 0.4
293 0.35
294 0.34
295 0.25
296 0.22
297 0.19
298 0.17
299 0.15
300 0.14
301 0.11
302 0.09
303 0.08
304 0.06
305 0.07
306 0.07
307 0.06
308 0.06
309 0.06
310 0.06
311 0.06
312 0.06
313 0.05
314 0.05
315 0.06
316 0.08
317 0.1
318 0.13
319 0.2
320 0.26
321 0.31
322 0.41
323 0.48
324 0.49
325 0.54
326 0.59
327 0.62
328 0.62
329 0.59
330 0.52
331 0.45
332 0.41
333 0.35
334 0.25
335 0.16
336 0.1
337 0.09
338 0.06
339 0.09
340 0.13
341 0.15
342 0.16
343 0.19
344 0.2
345 0.22
346 0.27
347 0.31
348 0.32
349 0.35
350 0.35
351 0.35
352 0.35
353 0.33
354 0.28
355 0.22
356 0.17
357 0.12
358 0.1
359 0.08
360 0.08
361 0.13
362 0.16
363 0.25
364 0.35
365 0.41
366 0.5
367 0.57
368 0.63
369 0.69
370 0.77
371 0.79
372 0.8
373 0.82
374 0.82
375 0.77
376 0.76
377 0.77
378 0.74
379 0.71
380 0.71
381 0.68
382 0.65
383 0.7
384 0.73
385 0.71
386 0.68
387 0.65
388 0.63
389 0.68
390 0.72
391 0.72
392 0.73
393 0.74
394 0.79
395 0.8
396 0.79
397 0.71
398 0.67
399 0.67
400 0.64
401 0.6
402 0.54
403 0.52
404 0.47
405 0.49
406 0.44
407 0.39
408 0.31
409 0.32
410 0.37
411 0.43
412 0.53
413 0.59
414 0.68
415 0.72
416 0.78
417 0.75
418 0.71
419 0.68
420 0.63
421 0.55
422 0.5
423 0.45
424 0.39
425 0.37
426 0.31
427 0.23
428 0.17
429 0.13
430 0.08
431 0.07
432 0.05
433 0.05
434 0.04
435 0.04
436 0.04
437 0.03
438 0.03
439 0.03
440 0.02
441 0.02
442 0.02
443 0.02
444 0.02
445 0.02
446 0.02
447 0.02
448 0.03
449 0.03
450 0.03
451 0.04
452 0.03
453 0.04
454 0.04
455 0.04
456 0.04
457 0.04
458 0.04
459 0.04
460 0.04
461 0.05
462 0.06
463 0.07
464 0.07
465 0.07
466 0.07
467 0.08
468 0.1
469 0.13
470 0.14
471 0.13
472 0.14
473 0.16
474 0.18
475 0.18
476 0.16
477 0.15
478 0.16
479 0.16
480 0.16
481 0.14
482 0.12
483 0.11
484 0.1
485 0.07
486 0.05
487 0.04
488 0.03
489 0.03
490 0.03
491 0.03
492 0.02
493 0.02
494 0.03
495 0.03
496 0.04
497 0.04
498 0.05
499 0.05
500 0.07
501 0.11
502 0.15
503 0.18