Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V6YUW5

Protein Details
Accession A0A1V6YUW5   
Localization Confidence High
Confidence Score 17.6
NoLS Segment(s)
PositionSequenceProtein Nature
74-94PVEPRRKREHSAPRRSRTNKYBasic
226-246NPFSELRKKINLRLKKRRNTHHydrophilic
NLS Segment(s)
PositionSequence
78-89RRKREHSAPRRS
233-244KKINLRLKKRRN
Subcellular Location(s) nucl 22, cyto_nucl 13.833, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013226  Pal1  
Pfam View protein in Pfam  
PF08316  Pal1  
Amino Acid Sequences MAVDCIHMAGGHHPHHPFNQVGQDRHQNVGTRMGSNNPYTSYISPSPSAYSRSRSVSVNSAPSIWYSGTPEHYPVEPRRKREHSAPRRSRTNKYPRYQLVQPDIIDRLDNVTNFSYHHEGPYDAARPERNRFSQSSPLEAVKESNAEALRATPHHKIADALNSHRPLDGVAFYPPGTTDRDGQEYSYEEGSNMMNDFSGNFMRLPGTKFTDEDFKNDPFYNRPLVNPFSELRKKINLRLKKRRNTH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.33
3 0.36
4 0.32
5 0.3
6 0.38
7 0.4
8 0.4
9 0.44
10 0.51
11 0.5
12 0.51
13 0.5
14 0.43
15 0.38
16 0.44
17 0.4
18 0.33
19 0.31
20 0.34
21 0.34
22 0.32
23 0.32
24 0.25
25 0.26
26 0.27
27 0.27
28 0.28
29 0.27
30 0.28
31 0.27
32 0.26
33 0.26
34 0.25
35 0.29
36 0.26
37 0.28
38 0.29
39 0.32
40 0.33
41 0.32
42 0.33
43 0.35
44 0.35
45 0.35
46 0.31
47 0.27
48 0.25
49 0.24
50 0.23
51 0.17
52 0.14
53 0.12
54 0.13
55 0.16
56 0.17
57 0.18
58 0.18
59 0.19
60 0.24
61 0.28
62 0.38
63 0.39
64 0.44
65 0.52
66 0.56
67 0.59
68 0.64
69 0.68
70 0.68
71 0.74
72 0.78
73 0.77
74 0.81
75 0.82
76 0.79
77 0.78
78 0.78
79 0.77
80 0.72
81 0.73
82 0.67
83 0.68
84 0.65
85 0.6
86 0.55
87 0.49
88 0.44
89 0.36
90 0.34
91 0.27
92 0.23
93 0.17
94 0.14
95 0.12
96 0.11
97 0.11
98 0.1
99 0.11
100 0.11
101 0.14
102 0.14
103 0.12
104 0.13
105 0.12
106 0.11
107 0.12
108 0.14
109 0.14
110 0.11
111 0.13
112 0.15
113 0.18
114 0.21
115 0.26
116 0.26
117 0.27
118 0.29
119 0.32
120 0.38
121 0.36
122 0.36
123 0.33
124 0.31
125 0.29
126 0.26
127 0.22
128 0.14
129 0.13
130 0.1
131 0.11
132 0.1
133 0.1
134 0.1
135 0.09
136 0.1
137 0.11
138 0.14
139 0.13
140 0.16
141 0.17
142 0.17
143 0.17
144 0.18
145 0.23
146 0.23
147 0.24
148 0.28
149 0.29
150 0.29
151 0.28
152 0.26
153 0.19
154 0.18
155 0.16
156 0.11
157 0.1
158 0.11
159 0.11
160 0.11
161 0.11
162 0.11
163 0.13
164 0.13
165 0.15
166 0.17
167 0.21
168 0.22
169 0.22
170 0.22
171 0.21
172 0.22
173 0.2
174 0.17
175 0.13
176 0.14
177 0.14
178 0.12
179 0.11
180 0.08
181 0.07
182 0.07
183 0.07
184 0.08
185 0.09
186 0.09
187 0.09
188 0.09
189 0.11
190 0.13
191 0.16
192 0.18
193 0.23
194 0.23
195 0.24
196 0.26
197 0.33
198 0.32
199 0.34
200 0.34
201 0.31
202 0.34
203 0.35
204 0.35
205 0.3
206 0.34
207 0.36
208 0.32
209 0.34
210 0.35
211 0.37
212 0.37
213 0.37
214 0.35
215 0.38
216 0.44
217 0.44
218 0.43
219 0.49
220 0.51
221 0.57
222 0.65
223 0.65
224 0.69
225 0.77
226 0.83