Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I4YJP4

Protein Details
Accession I4YJP4    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
21-44AQEHKNRSSKHRSHWPRPKTPPGYBasic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito 5, cyto 3, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013882  Ctp1_C  
Gene Ontology GO:0005634  C:nucleus  
GO:0006281  P:DNA repair  
KEGG wse:WALSEDRAFT_34786  -  
Pfam View protein in Pfam  
PF08573  SAE2  
Amino Acid Sequences MVGGDCLCCRDFWNSVGQDTAQEHKNRSSKHRSHWPRPKTPPGYWDVDFPSTQKIALNKEQARQMHKEKREWAAAEANKDNGRHLRRKSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.27
4 0.25
5 0.24
6 0.23
7 0.26
8 0.23
9 0.24
10 0.25
11 0.31
12 0.37
13 0.38
14 0.44
15 0.51
16 0.51
17 0.57
18 0.66
19 0.68
20 0.73
21 0.8
22 0.81
23 0.8
24 0.82
25 0.84
26 0.79
27 0.72
28 0.65
29 0.59
30 0.55
31 0.46
32 0.4
33 0.32
34 0.27
35 0.25
36 0.21
37 0.2
38 0.14
39 0.14
40 0.14
41 0.14
42 0.17
43 0.22
44 0.31
45 0.31
46 0.34
47 0.39
48 0.41
49 0.43
50 0.44
51 0.49
52 0.49
53 0.53
54 0.56
55 0.56
56 0.58
57 0.6
58 0.56
59 0.5
60 0.5
61 0.47
62 0.47
63 0.44
64 0.43
65 0.39
66 0.38
67 0.39
68 0.38
69 0.43
70 0.45