Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V6X1Q2

Protein Details
Accession A0A1V6X1Q2    Localization Confidence Low Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
11-36RHSNSLKLVRQKQARRRNSLLRKSFEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 4, cyto 4, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
Amino Acid Sequences MAVEQKIIRARHSNSLKLVRQKQARRRNSLLRKSFEYCRDCDADVFMMIRLKRNGQILFFNSNAQWPLSREQLASHYPTPQEITWHEMATKYAGGEGVSAGEPTAQRQQGDGSTHGDGDGFDSHTGQTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.6
3 0.62
4 0.64
5 0.68
6 0.67
7 0.7
8 0.74
9 0.77
10 0.79
11 0.81
12 0.8
13 0.8
14 0.82
15 0.83
16 0.84
17 0.82
18 0.77
19 0.73
20 0.69
21 0.68
22 0.65
23 0.58
24 0.5
25 0.45
26 0.42
27 0.37
28 0.33
29 0.28
30 0.2
31 0.17
32 0.16
33 0.12
34 0.13
35 0.12
36 0.16
37 0.15
38 0.15
39 0.17
40 0.22
41 0.22
42 0.2
43 0.23
44 0.23
45 0.25
46 0.24
47 0.22
48 0.18
49 0.18
50 0.17
51 0.13
52 0.11
53 0.09
54 0.11
55 0.13
56 0.13
57 0.13
58 0.13
59 0.16
60 0.18
61 0.2
62 0.18
63 0.18
64 0.18
65 0.18
66 0.2
67 0.16
68 0.17
69 0.14
70 0.19
71 0.18
72 0.18
73 0.18
74 0.16
75 0.17
76 0.15
77 0.15
78 0.09
79 0.08
80 0.08
81 0.08
82 0.07
83 0.07
84 0.07
85 0.06
86 0.06
87 0.06
88 0.07
89 0.07
90 0.1
91 0.17
92 0.17
93 0.17
94 0.18
95 0.21
96 0.24
97 0.27
98 0.26
99 0.23
100 0.22
101 0.22
102 0.21
103 0.19
104 0.15
105 0.14
106 0.14
107 0.12
108 0.11
109 0.12