Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1V6V426

Protein Details
Accession A0A1V6V426    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
20-42IDNLVRTRVRRRKEREKLLAPVRHydrophilic
NLS Segment(s)
PositionSequence
29-34RRRKER
Subcellular Location(s) plas 9, mito 7, E.R. 3, nucl 2, cyto 2, extr 2, cyto_nucl 2, pero 2, cyto_pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MWLLLRLSLTIAAIGSFMLIDNLVRTRVRRRKEREKLLAPVRPLLDLLLRRPLLIRVRVRLERFLQLRLRLAGLMPLLLNLRRSARL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.04
4 0.04
5 0.04
6 0.04
7 0.04
8 0.05
9 0.06
10 0.08
11 0.09
12 0.12
13 0.22
14 0.3
15 0.38
16 0.47
17 0.55
18 0.65
19 0.74
20 0.82
21 0.82
22 0.8
23 0.8
24 0.78
25 0.72
26 0.62
27 0.55
28 0.44
29 0.35
30 0.29
31 0.21
32 0.16
33 0.14
34 0.14
35 0.17
36 0.17
37 0.16
38 0.17
39 0.21
40 0.23
41 0.29
42 0.31
43 0.29
44 0.36
45 0.42
46 0.43
47 0.44
48 0.42
49 0.42
50 0.41
51 0.42
52 0.41
53 0.38
54 0.4
55 0.36
56 0.34
57 0.26
58 0.24
59 0.21
60 0.16
61 0.14
62 0.1
63 0.1
64 0.12
65 0.13
66 0.14
67 0.14