Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I4YC93

Protein Details
Accession I4YC93   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
175-197KEILFAYKKRRRADKQFFKMLAKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR033684  EFM6  
IPR019410  Methyltransf_16  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0016279  F:protein-lysine N-methyltransferase activity  
GO:0018022  P:peptidyl-lysine methylation  
KEGG wse:WALSEDRAFT_60332  -  
Pfam View protein in Pfam  
PF10294  Methyltransf_16  
CDD cd02440  AdoMet_MTases  
Amino Acid Sequences MREDIENEEMILPVPDSSDEETSIEPVASLQSVQVAGVDLHLQHDKTEGCGGMVWESGKVLTRYITQKKLASYENTTVLELGAGTGIVGLALSKLVPSSKVYITDIPQIMPLIEKGIRINELTNAIPETLVWGERLPRLDSNPSVLLLADCVYYEPSFQPLVDTLVELTDRYTIKEILFAYKKRRRADKQFFKMLAKRFKYNQVTDDPDAEIYNRDSISLFTLERRM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.1
4 0.13
5 0.14
6 0.14
7 0.15
8 0.16
9 0.16
10 0.16
11 0.13
12 0.1
13 0.09
14 0.09
15 0.08
16 0.07
17 0.06
18 0.07
19 0.07
20 0.07
21 0.07
22 0.07
23 0.07
24 0.07
25 0.08
26 0.07
27 0.09
28 0.12
29 0.11
30 0.11
31 0.14
32 0.13
33 0.14
34 0.17
35 0.14
36 0.12
37 0.13
38 0.14
39 0.12
40 0.13
41 0.11
42 0.09
43 0.09
44 0.09
45 0.11
46 0.11
47 0.1
48 0.1
49 0.15
50 0.23
51 0.29
52 0.34
53 0.35
54 0.38
55 0.39
56 0.41
57 0.4
58 0.36
59 0.35
60 0.32
61 0.33
62 0.31
63 0.29
64 0.25
65 0.22
66 0.17
67 0.12
68 0.09
69 0.04
70 0.03
71 0.03
72 0.02
73 0.02
74 0.02
75 0.02
76 0.02
77 0.02
78 0.02
79 0.02
80 0.02
81 0.03
82 0.03
83 0.04
84 0.06
85 0.09
86 0.1
87 0.12
88 0.14
89 0.15
90 0.17
91 0.21
92 0.2
93 0.17
94 0.16
95 0.15
96 0.13
97 0.11
98 0.1
99 0.07
100 0.07
101 0.07
102 0.07
103 0.08
104 0.09
105 0.09
106 0.09
107 0.09
108 0.1
109 0.1
110 0.1
111 0.1
112 0.09
113 0.08
114 0.08
115 0.08
116 0.06
117 0.07
118 0.06
119 0.06
120 0.08
121 0.1
122 0.12
123 0.12
124 0.13
125 0.16
126 0.19
127 0.19
128 0.21
129 0.2
130 0.19
131 0.17
132 0.16
133 0.13
134 0.1
135 0.1
136 0.06
137 0.05
138 0.05
139 0.06
140 0.06
141 0.07
142 0.07
143 0.09
144 0.1
145 0.09
146 0.1
147 0.09
148 0.12
149 0.11
150 0.11
151 0.08
152 0.09
153 0.09
154 0.08
155 0.08
156 0.1
157 0.1
158 0.11
159 0.14
160 0.14
161 0.14
162 0.18
163 0.18
164 0.22
165 0.28
166 0.31
167 0.39
168 0.45
169 0.53
170 0.56
171 0.66
172 0.67
173 0.72
174 0.8
175 0.8
176 0.83
177 0.85
178 0.82
179 0.79
180 0.76
181 0.74
182 0.73
183 0.66
184 0.64
185 0.58
186 0.64
187 0.66
188 0.63
189 0.6
190 0.57
191 0.6
192 0.55
193 0.53
194 0.44
195 0.37
196 0.33
197 0.28
198 0.23
199 0.18
200 0.19
201 0.16
202 0.16
203 0.15
204 0.15
205 0.18
206 0.18
207 0.17