Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I4Y9L9

Protein Details
Accession I4Y9L9   
Localization Confidence Low
Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
94-119DIEKKEKEIKKMTPRPVQPKNKVVSFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11.5, mito_nucl 9.833, cyto_nucl 7.833, cyto 7.5, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR042246  ZCCHC9  
IPR001878  Znf_CCHC  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
KEGG wse:WALSEDRAFT_60785  -  
Pfam View protein in Pfam  
PF00098  zf-CCHC  
Amino Acid Sequences MCRKPKPKNGPELPFASCFICDGKGHLASQCSKNERGVYPRGGECKICQSVEHLAKDCPTRSEKEKPAFVIGTGTIGGNADEDDFHVLSSRKTDIEKKEKEIKKMTPRPVQPKNKVVSF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.51
3 0.41
4 0.31
5 0.25
6 0.2
7 0.18
8 0.14
9 0.15
10 0.18
11 0.19
12 0.19
13 0.2
14 0.23
15 0.25
16 0.3
17 0.33
18 0.33
19 0.33
20 0.35
21 0.37
22 0.36
23 0.37
24 0.37
25 0.34
26 0.33
27 0.34
28 0.35
29 0.32
30 0.3
31 0.26
32 0.28
33 0.27
34 0.24
35 0.21
36 0.2
37 0.26
38 0.3
39 0.31
40 0.26
41 0.24
42 0.25
43 0.27
44 0.25
45 0.2
46 0.18
47 0.19
48 0.23
49 0.31
50 0.36
51 0.39
52 0.41
53 0.4
54 0.41
55 0.37
56 0.32
57 0.25
58 0.18
59 0.14
60 0.11
61 0.09
62 0.06
63 0.06
64 0.06
65 0.05
66 0.05
67 0.04
68 0.04
69 0.04
70 0.07
71 0.07
72 0.07
73 0.09
74 0.09
75 0.1
76 0.12
77 0.14
78 0.13
79 0.16
80 0.24
81 0.31
82 0.41
83 0.46
84 0.51
85 0.6
86 0.64
87 0.68
88 0.69
89 0.69
90 0.7
91 0.74
92 0.77
93 0.76
94 0.8
95 0.83
96 0.86
97 0.87
98 0.85
99 0.84