Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I4Y743

Protein Details
Accession I4Y743   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
59-88MELIRNSKDKKARKLTKKRLGTLRRAKGKVBasic
NLS Segment(s)
PositionSequence
23-39KRVKPSHRKGANSERGR
63-87RNSKDKKARKLTKKRLGTLRRAKGK
Subcellular Location(s) mito 13, nucl 10, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG wse:WALSEDRAFT_61283  -  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
PROSITE View protein in PROSITE  
PS01190  RIBOSOMAL_L36E  
Amino Acid Sequences MSTTTNNLRVGLNKGFPTTQLPKRVKPSHRKGANSERGRLVKGVVREVAGFAPYEKRVMELIRNSKDKKARKLTKKRLGTLRRAKGKVEELSTVIQEARTKGTN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.28
3 0.28
4 0.32
5 0.34
6 0.36
7 0.42
8 0.45
9 0.49
10 0.59
11 0.67
12 0.69
13 0.72
14 0.75
15 0.76
16 0.79
17 0.77
18 0.76
19 0.77
20 0.78
21 0.72
22 0.65
23 0.61
24 0.55
25 0.51
26 0.43
27 0.34
28 0.26
29 0.24
30 0.22
31 0.16
32 0.15
33 0.14
34 0.14
35 0.13
36 0.1
37 0.09
38 0.07
39 0.08
40 0.08
41 0.09
42 0.08
43 0.09
44 0.1
45 0.11
46 0.14
47 0.19
48 0.26
49 0.31
50 0.37
51 0.38
52 0.43
53 0.5
54 0.54
55 0.57
56 0.6
57 0.65
58 0.71
59 0.8
60 0.86
61 0.88
62 0.89
63 0.87
64 0.86
65 0.84
66 0.84
67 0.83
68 0.82
69 0.82
70 0.75
71 0.69
72 0.65
73 0.64
74 0.59
75 0.52
76 0.44
77 0.37
78 0.37
79 0.35
80 0.3
81 0.23
82 0.19
83 0.18
84 0.18