Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I4YHN2

Protein Details
Accession I4YHN2    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
344-372KLYSINKDREERRRLRKRIKTRNDLEEKABasic
NLS Segment(s)
PositionSequence
350-364KDREERRRLRKRIKT
Subcellular Location(s) nucl 23, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038765  Papain-like_cys_pep_sf  
IPR001394  Peptidase_C19_UCH  
IPR000626  Ubiquitin-like_dom  
IPR029071  Ubiquitin-like_domsf  
IPR019954  Ubiquitin_CS  
IPR044635  UBP14-like  
IPR018200  USP_CS  
IPR028889  USP_dom  
Gene Ontology GO:0004843  F:cysteine-type deubiquitinase activity  
GO:0043161  P:proteasome-mediated ubiquitin-dependent protein catabolic process  
GO:0016579  P:protein deubiquitination  
KEGG wse:WALSEDRAFT_59213  -  
Pfam View protein in Pfam  
PF00240  ubiquitin  
PF00443  UCH  
PROSITE View protein in PROSITE  
PS00299  UBIQUITIN_1  
PS50053  UBIQUITIN_2  
PS00972  USP_1  
PS00973  USP_2  
PS50235  USP_3  
CDD cd16104  Ubl_USP14_like  
Amino Acid Sequences MTKIPVSIKHAGKKLDLDLNTQASGLDFKNDIYAITGVAPERQKVMIKGGILKDDTDMEKLGSTIKPGHLFMVIGAAGPLPSAPTEKVVFMEDLDDKQLSQALKNPVGLTNLGNTCYLNSSIQVLRAIPELQNNLNNSQNNGLSRSLEALFSSLNNSTDAITPTSFLTTLRSNYQQFTERDRFGQFAQQDAEEAWGAILSSLAGTTGMEGKSFVDQYMRGSYVKEMSTPEAPEEEPTYSIEEFTKLGCNISSNTNYLQQGLSEGLDEQIEKYSGTLNRNAQYVQKSRINRLPSYLTVHLVRFYWRADLGKKAKILRKVKFPMEYDASELVSDDLKAKINPVNKKLYSINKDREERRRLRKRIKTRNDLEEKANNSKNNDEMLIDEIKDEQNKIGDAELLSEEVYQAKEKKELDELVDEDLKNDIGSSKSGLYDLVGIVTHKGVNADGGHYIGWVRGDVHKGEEHQDDWYKFDDNKVSKISKEKIAQLEGGGEDSVAYLLLYKAKM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.52
3 0.46
4 0.43
5 0.43
6 0.43
7 0.39
8 0.35
9 0.29
10 0.21
11 0.23
12 0.18
13 0.16
14 0.13
15 0.13
16 0.15
17 0.15
18 0.15
19 0.15
20 0.14
21 0.12
22 0.12
23 0.14
24 0.12
25 0.17
26 0.19
27 0.17
28 0.19
29 0.21
30 0.23
31 0.23
32 0.29
33 0.27
34 0.28
35 0.34
36 0.34
37 0.36
38 0.34
39 0.33
40 0.28
41 0.28
42 0.27
43 0.22
44 0.2
45 0.16
46 0.15
47 0.15
48 0.17
49 0.14
50 0.15
51 0.18
52 0.21
53 0.24
54 0.24
55 0.25
56 0.22
57 0.22
58 0.19
59 0.19
60 0.14
61 0.11
62 0.1
63 0.09
64 0.08
65 0.08
66 0.07
67 0.04
68 0.05
69 0.07
70 0.08
71 0.11
72 0.13
73 0.14
74 0.15
75 0.16
76 0.16
77 0.14
78 0.17
79 0.15
80 0.15
81 0.17
82 0.16
83 0.13
84 0.13
85 0.17
86 0.14
87 0.13
88 0.19
89 0.24
90 0.26
91 0.28
92 0.29
93 0.27
94 0.29
95 0.29
96 0.22
97 0.22
98 0.2
99 0.2
100 0.19
101 0.17
102 0.16
103 0.17
104 0.17
105 0.12
106 0.11
107 0.14
108 0.14
109 0.16
110 0.16
111 0.15
112 0.14
113 0.15
114 0.16
115 0.13
116 0.16
117 0.18
118 0.19
119 0.22
120 0.23
121 0.24
122 0.28
123 0.28
124 0.26
125 0.26
126 0.26
127 0.23
128 0.24
129 0.22
130 0.18
131 0.17
132 0.19
133 0.16
134 0.14
135 0.13
136 0.11
137 0.1
138 0.09
139 0.11
140 0.1
141 0.1
142 0.1
143 0.1
144 0.1
145 0.12
146 0.13
147 0.13
148 0.12
149 0.12
150 0.12
151 0.12
152 0.11
153 0.09
154 0.11
155 0.12
156 0.14
157 0.17
158 0.21
159 0.22
160 0.23
161 0.26
162 0.3
163 0.29
164 0.36
165 0.38
166 0.35
167 0.36
168 0.35
169 0.34
170 0.28
171 0.32
172 0.24
173 0.21
174 0.2
175 0.18
176 0.17
177 0.16
178 0.16
179 0.1
180 0.09
181 0.06
182 0.05
183 0.05
184 0.04
185 0.04
186 0.03
187 0.02
188 0.02
189 0.02
190 0.03
191 0.02
192 0.03
193 0.06
194 0.06
195 0.06
196 0.07
197 0.07
198 0.09
199 0.09
200 0.09
201 0.07
202 0.08
203 0.1
204 0.12
205 0.13
206 0.12
207 0.12
208 0.13
209 0.15
210 0.15
211 0.14
212 0.13
213 0.14
214 0.16
215 0.15
216 0.15
217 0.13
218 0.13
219 0.13
220 0.13
221 0.11
222 0.1
223 0.1
224 0.12
225 0.1
226 0.11
227 0.1
228 0.09
229 0.09
230 0.09
231 0.11
232 0.09
233 0.09
234 0.08
235 0.09
236 0.1
237 0.13
238 0.14
239 0.13
240 0.14
241 0.17
242 0.17
243 0.17
244 0.16
245 0.12
246 0.11
247 0.1
248 0.09
249 0.06
250 0.06
251 0.05
252 0.05
253 0.05
254 0.05
255 0.05
256 0.05
257 0.05
258 0.05
259 0.09
260 0.12
261 0.14
262 0.19
263 0.21
264 0.23
265 0.24
266 0.24
267 0.24
268 0.27
269 0.28
270 0.29
271 0.32
272 0.32
273 0.36
274 0.41
275 0.42
276 0.36
277 0.36
278 0.35
279 0.31
280 0.34
281 0.31
282 0.28
283 0.25
284 0.25
285 0.22
286 0.19
287 0.19
288 0.14
289 0.14
290 0.13
291 0.13
292 0.15
293 0.16
294 0.24
295 0.27
296 0.29
297 0.33
298 0.37
299 0.4
300 0.47
301 0.54
302 0.5
303 0.56
304 0.58
305 0.6
306 0.6
307 0.57
308 0.53
309 0.49
310 0.45
311 0.38
312 0.33
313 0.28
314 0.21
315 0.19
316 0.14
317 0.1
318 0.1
319 0.08
320 0.08
321 0.09
322 0.09
323 0.11
324 0.14
325 0.21
326 0.27
327 0.31
328 0.39
329 0.38
330 0.42
331 0.46
332 0.51
333 0.51
334 0.54
335 0.57
336 0.57
337 0.63
338 0.67
339 0.71
340 0.71
341 0.74
342 0.76
343 0.78
344 0.8
345 0.84
346 0.88
347 0.89
348 0.91
349 0.92
350 0.91
351 0.88
352 0.88
353 0.86
354 0.79
355 0.73
356 0.69
357 0.63
358 0.61
359 0.59
360 0.51
361 0.45
362 0.44
363 0.4
364 0.35
365 0.3
366 0.22
367 0.18
368 0.18
369 0.17
370 0.15
371 0.13
372 0.13
373 0.15
374 0.15
375 0.15
376 0.13
377 0.13
378 0.14
379 0.14
380 0.13
381 0.13
382 0.11
383 0.13
384 0.12
385 0.11
386 0.1
387 0.1
388 0.09
389 0.09
390 0.1
391 0.11
392 0.14
393 0.15
394 0.2
395 0.21
396 0.24
397 0.28
398 0.29
399 0.29
400 0.31
401 0.3
402 0.29
403 0.32
404 0.29
405 0.24
406 0.23
407 0.2
408 0.15
409 0.14
410 0.11
411 0.08
412 0.1
413 0.11
414 0.12
415 0.12
416 0.13
417 0.13
418 0.12
419 0.12
420 0.11
421 0.1
422 0.09
423 0.09
424 0.09
425 0.1
426 0.1
427 0.09
428 0.09
429 0.08
430 0.11
431 0.11
432 0.12
433 0.12
434 0.12
435 0.12
436 0.11
437 0.12
438 0.1
439 0.09
440 0.08
441 0.1
442 0.13
443 0.17
444 0.17
445 0.21
446 0.23
447 0.25
448 0.29
449 0.3
450 0.27
451 0.3
452 0.37
453 0.34
454 0.33
455 0.33
456 0.32
457 0.29
458 0.33
459 0.37
460 0.32
461 0.37
462 0.42
463 0.43
464 0.44
465 0.52
466 0.52
467 0.51
468 0.54
469 0.56
470 0.56
471 0.57
472 0.54
473 0.46
474 0.44
475 0.35
476 0.31
477 0.23
478 0.16
479 0.12
480 0.11
481 0.1
482 0.06
483 0.05
484 0.05
485 0.06