Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1V6PFS9

Protein Details
Accession A0A1V6PFS9    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
85-104IEAKRIKRPRYNTKERARKCBasic
NLS Segment(s)
PositionSequence
91-93KRP
Subcellular Location(s) nucl 21.5, cyto_nucl 15, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MPYTRFPSSDEEEFFRVAAQQRRASAYGGRERARASAPVPTNAAASGSPSISFRTRRGVTPLVQASGVPNTPSRPVNSNLTTPAIEAKRIKRPRYNTKERARKCITCTGIGRVCTWSEDSNGKALPRCDDCTNRNKKCSDIPFSTEILDRYLAALADTSPAIDIAPINRPRADFLKAVKRYTQESNRAAKDSGKETTLVTSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.27
3 0.25
4 0.26
5 0.3
6 0.33
7 0.35
8 0.37
9 0.41
10 0.42
11 0.4
12 0.38
13 0.39
14 0.41
15 0.44
16 0.43
17 0.41
18 0.4
19 0.41
20 0.39
21 0.33
22 0.25
23 0.27
24 0.28
25 0.28
26 0.29
27 0.27
28 0.25
29 0.22
30 0.22
31 0.13
32 0.13
33 0.11
34 0.1
35 0.1
36 0.1
37 0.13
38 0.16
39 0.19
40 0.18
41 0.26
42 0.27
43 0.29
44 0.35
45 0.36
46 0.34
47 0.39
48 0.4
49 0.32
50 0.3
51 0.28
52 0.23
53 0.21
54 0.19
55 0.12
56 0.11
57 0.11
58 0.14
59 0.15
60 0.16
61 0.18
62 0.2
63 0.26
64 0.27
65 0.28
66 0.27
67 0.27
68 0.25
69 0.22
70 0.24
71 0.18
72 0.19
73 0.21
74 0.23
75 0.31
76 0.38
77 0.43
78 0.45
79 0.53
80 0.61
81 0.67
82 0.74
83 0.74
84 0.77
85 0.83
86 0.78
87 0.79
88 0.74
89 0.67
90 0.61
91 0.59
92 0.51
93 0.45
94 0.44
95 0.4
96 0.37
97 0.35
98 0.31
99 0.24
100 0.22
101 0.18
102 0.19
103 0.14
104 0.13
105 0.14
106 0.14
107 0.15
108 0.15
109 0.16
110 0.16
111 0.16
112 0.18
113 0.19
114 0.22
115 0.24
116 0.29
117 0.33
118 0.41
119 0.51
120 0.53
121 0.55
122 0.52
123 0.51
124 0.54
125 0.57
126 0.54
127 0.47
128 0.46
129 0.44
130 0.44
131 0.42
132 0.36
133 0.29
134 0.23
135 0.19
136 0.14
137 0.12
138 0.11
139 0.1
140 0.08
141 0.08
142 0.06
143 0.07
144 0.07
145 0.06
146 0.05
147 0.05
148 0.05
149 0.05
150 0.06
151 0.07
152 0.16
153 0.19
154 0.22
155 0.23
156 0.24
157 0.28
158 0.31
159 0.32
160 0.28
161 0.32
162 0.4
163 0.43
164 0.46
165 0.46
166 0.46
167 0.47
168 0.52
169 0.55
170 0.53
171 0.56
172 0.62
173 0.62
174 0.62
175 0.59
176 0.53
177 0.5
178 0.45
179 0.41
180 0.33
181 0.3
182 0.28