Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I4YFJ1

Protein Details
Accession I4YFJ1    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-21KKHNSRIKSKYPDGWKPKNKBasic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito_nucl 12.999, cyto_nucl 10.833, mito 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010487  NGRN/Rrg9  
Gene Ontology GO:0005739  C:mitochondrion  
KEGG wse:WALSEDRAFT_4712  -  
Pfam View protein in Pfam  
PF06413  Neugrin  
Amino Acid Sequences WKKHNSRIKSKYPDGWKPKNKLSRAAMIGIKELHQYDSLQFNVASLSEKFKRSPESIRRILKSNWIPDQQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.81
3 0.79
4 0.77
5 0.79
6 0.79
7 0.73
8 0.71
9 0.65
10 0.62
11 0.56
12 0.53
13 0.46
14 0.37
15 0.36
16 0.28
17 0.24
18 0.17
19 0.15
20 0.12
21 0.1
22 0.1
23 0.1
24 0.12
25 0.12
26 0.12
27 0.11
28 0.1
29 0.1
30 0.1
31 0.1
32 0.08
33 0.14
34 0.16
35 0.18
36 0.19
37 0.22
38 0.28
39 0.29
40 0.39
41 0.43
42 0.49
43 0.57
44 0.64
45 0.64
46 0.64
47 0.62
48 0.62
49 0.6
50 0.59
51 0.58