Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V6PUW8

Protein Details
Accession A0A1V6PUW8   
Localization Confidence High
Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
100-122EATLKEKKEKEERKKSLHQEGLABasic
NLS Segment(s)
PositionSequence
105-133EKKEKEERKKSLHQEGLADKLKNKLLGRK
Subcellular Location(s) nucl 22, cyto 4.5, cyto_pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR022024  DUF3602  
Pfam View protein in Pfam  
PF12223  DUF3602  
Amino Acid Sequences MGEHDSPMVSHGRGGQGNIGHDDTEYVDGEIVREGVYGDQGDGAYSAGRGGAGNIGSPMVRPTSKVPHDNEMIPELAVRGSTDENYHIGRGGQGNVHLDEATLKEKKEKEERKKSLHQEGLADKLKNKLLGRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.22
3 0.22
4 0.24
5 0.25
6 0.23
7 0.18
8 0.17
9 0.17
10 0.14
11 0.14
12 0.12
13 0.1
14 0.09
15 0.09
16 0.1
17 0.09
18 0.08
19 0.06
20 0.05
21 0.06
22 0.05
23 0.06
24 0.06
25 0.06
26 0.06
27 0.06
28 0.06
29 0.06
30 0.06
31 0.05
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.04
38 0.05
39 0.05
40 0.05
41 0.05
42 0.05
43 0.05
44 0.05
45 0.06
46 0.06
47 0.06
48 0.08
49 0.11
50 0.18
51 0.22
52 0.27
53 0.29
54 0.31
55 0.33
56 0.32
57 0.31
58 0.24
59 0.21
60 0.15
61 0.13
62 0.09
63 0.07
64 0.06
65 0.05
66 0.05
67 0.06
68 0.06
69 0.07
70 0.08
71 0.1
72 0.11
73 0.11
74 0.1
75 0.09
76 0.11
77 0.11
78 0.11
79 0.1
80 0.11
81 0.13
82 0.14
83 0.14
84 0.12
85 0.11
86 0.11
87 0.12
88 0.15
89 0.15
90 0.15
91 0.2
92 0.23
93 0.31
94 0.41
95 0.5
96 0.56
97 0.65
98 0.74
99 0.76
100 0.84
101 0.85
102 0.85
103 0.81
104 0.72
105 0.68
106 0.63
107 0.63
108 0.59
109 0.52
110 0.43
111 0.42
112 0.43
113 0.42