Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1V6PWC3

Protein Details
Accession A0A1V6PWC3    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
190-215TVTYKRTHLDPPPKGKRRKTSETRDTHydrophilic
NLS Segment(s)
PositionSequence
202-208PKGKRRK
Subcellular Location(s) nucl 17.5, cyto_nucl 12.5, cyto 4.5, mito 4
Family & Domain DBs
Amino Acid Sequences MPSAKPVLPLLKTPKTMTFPSELHDSPLTAGPLTAGSDIIKREEGSATPISPPQAYTEFLKALTPVFTSPVSAGVEFSRFKFEKRRPSPISVPPSATSTTFSAHDNPKVASATLPPPSPAPSPQSAKPPTMLRRLRIPQTCIYSPVSDSPRSARTLRSPFSPSDWKIRYIETPRSAGGKSVSVRQVVTRTVTYKRTHLDPPPKGKRRKTSETRDT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.49
3 0.49
4 0.45
5 0.42
6 0.36
7 0.36
8 0.39
9 0.33
10 0.32
11 0.3
12 0.27
13 0.23
14 0.26
15 0.23
16 0.17
17 0.16
18 0.12
19 0.12
20 0.13
21 0.11
22 0.08
23 0.08
24 0.1
25 0.11
26 0.13
27 0.13
28 0.13
29 0.14
30 0.14
31 0.14
32 0.17
33 0.18
34 0.17
35 0.17
36 0.18
37 0.19
38 0.17
39 0.17
40 0.16
41 0.16
42 0.17
43 0.18
44 0.19
45 0.19
46 0.19
47 0.18
48 0.15
49 0.14
50 0.13
51 0.11
52 0.09
53 0.1
54 0.1
55 0.1
56 0.1
57 0.12
58 0.12
59 0.11
60 0.11
61 0.1
62 0.13
63 0.13
64 0.13
65 0.18
66 0.17
67 0.19
68 0.28
69 0.34
70 0.42
71 0.48
72 0.58
73 0.55
74 0.62
75 0.67
76 0.66
77 0.66
78 0.57
79 0.53
80 0.43
81 0.41
82 0.35
83 0.29
84 0.22
85 0.16
86 0.15
87 0.14
88 0.14
89 0.15
90 0.17
91 0.18
92 0.17
93 0.16
94 0.16
95 0.16
96 0.15
97 0.11
98 0.11
99 0.13
100 0.14
101 0.14
102 0.13
103 0.13
104 0.15
105 0.16
106 0.16
107 0.16
108 0.19
109 0.23
110 0.24
111 0.32
112 0.32
113 0.32
114 0.34
115 0.36
116 0.37
117 0.43
118 0.44
119 0.38
120 0.44
121 0.48
122 0.53
123 0.51
124 0.5
125 0.46
126 0.49
127 0.47
128 0.41
129 0.39
130 0.32
131 0.28
132 0.3
133 0.29
134 0.23
135 0.24
136 0.24
137 0.25
138 0.28
139 0.28
140 0.26
141 0.31
142 0.37
143 0.38
144 0.39
145 0.4
146 0.37
147 0.42
148 0.47
149 0.4
150 0.43
151 0.43
152 0.41
153 0.4
154 0.41
155 0.42
156 0.41
157 0.47
158 0.41
159 0.42
160 0.4
161 0.41
162 0.39
163 0.33
164 0.29
165 0.26
166 0.23
167 0.28
168 0.3
169 0.28
170 0.28
171 0.29
172 0.3
173 0.27
174 0.29
175 0.26
176 0.26
177 0.3
178 0.36
179 0.36
180 0.39
181 0.41
182 0.42
183 0.45
184 0.52
185 0.57
186 0.6
187 0.68
188 0.74
189 0.79
190 0.84
191 0.87
192 0.88
193 0.86
194 0.88
195 0.87