Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I4Y7J0

Protein Details
Accession I4Y7J0    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
84-104KVFTNRKRKHSDDYHHNQRLRBasic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 13
Family & Domain DBs
KEGG wse:WALSEDRAFT_33735  -  
Amino Acid Sequences MASNAGLIKSSSFTSFEIHKTTRKSVKMSSWQTHHMKLKQLEDVINSYASLKDFADALSAKIAQLEYLQNGETRQVTTIDLGTKVFTNRKRKHSDDYHHNQRLRDLQRDVWWK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.19
3 0.21
4 0.25
5 0.27
6 0.31
7 0.33
8 0.41
9 0.46
10 0.47
11 0.49
12 0.48
13 0.54
14 0.59
15 0.63
16 0.61
17 0.57
18 0.61
19 0.6
20 0.62
21 0.6
22 0.53
23 0.53
24 0.5
25 0.49
26 0.44
27 0.42
28 0.36
29 0.31
30 0.29
31 0.23
32 0.18
33 0.15
34 0.12
35 0.11
36 0.1
37 0.09
38 0.07
39 0.06
40 0.06
41 0.06
42 0.08
43 0.07
44 0.07
45 0.07
46 0.07
47 0.07
48 0.07
49 0.07
50 0.05
51 0.06
52 0.07
53 0.07
54 0.07
55 0.08
56 0.08
57 0.08
58 0.1
59 0.09
60 0.09
61 0.09
62 0.09
63 0.1
64 0.1
65 0.11
66 0.11
67 0.11
68 0.11
69 0.11
70 0.11
71 0.14
72 0.2
73 0.26
74 0.36
75 0.43
76 0.53
77 0.6
78 0.64
79 0.71
80 0.75
81 0.77
82 0.77
83 0.79
84 0.81
85 0.81
86 0.8
87 0.71
88 0.67
89 0.66
90 0.62
91 0.59
92 0.53
93 0.5