Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V6Q443

Protein Details
Accession A0A1V6Q443    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
14-33LYRKCLREIRKKPTESRPNFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 9.5, cyto_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR008011  Complex1_LYR_dom  
IPR045295  Complex1_LYR_SDHAF1_LYRM8  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0034553  P:mitochondrial respiratory chain complex II assembly  
Pfam View protein in Pfam  
PF05347  Complex1_LYR  
CDD cd20268  Complex1_LYR_SDHAF1_LYRM8  
Amino Acid Sequences MARLSGLQRDVLSLYRKCLREIRKKPTESRPNFKTHARAEFQKHLSVNKKDFSAVEYLLRKGHRQLEMYASPGIRNIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.32
3 0.33
4 0.34
5 0.41
6 0.46
7 0.51
8 0.6
9 0.65
10 0.67
11 0.72
12 0.76
13 0.79
14 0.8
15 0.77
16 0.76
17 0.71
18 0.67
19 0.65
20 0.61
21 0.57
22 0.5
23 0.49
24 0.43
25 0.43
26 0.42
27 0.46
28 0.45
29 0.41
30 0.38
31 0.37
32 0.42
33 0.43
34 0.41
35 0.36
36 0.35
37 0.32
38 0.31
39 0.27
40 0.23
41 0.18
42 0.21
43 0.21
44 0.21
45 0.24
46 0.26
47 0.25
48 0.27
49 0.33
50 0.32
51 0.32
52 0.34
53 0.38
54 0.38
55 0.39
56 0.38
57 0.32
58 0.27