Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I4YIU0

Protein Details
Accession I4YIU0    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
120-151DINLDSVKRKRKSKMNKHKYRKRRKVCTLVFCHydrophilic
NLS Segment(s)
PositionSequence
127-144KRKRKSKMNKHKYRKRRK
Subcellular Location(s) mito 14, nucl 11.5, cyto_nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR013177  COX24_C  
KEGG wse:WALSEDRAFT_61713  -  
Pfam View protein in Pfam  
PF08213  COX24_C  
Amino Acid Sequences MLNRARAVLRAPRVASARCHSSINSFDRTLYLKEQPEDSVFKSLENKQNLAFETFVAGHRPLFISNPPLESSNQVSHKLTDEQVDSILDELDCALFKVKITEIADYKSALHRIGLGERLDINLDSVKRKRKSKMNKHKYRKRRKVCTLVFC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.44
3 0.42
4 0.42
5 0.38
6 0.38
7 0.34
8 0.35
9 0.4
10 0.39
11 0.38
12 0.32
13 0.3
14 0.31
15 0.33
16 0.3
17 0.28
18 0.29
19 0.27
20 0.28
21 0.3
22 0.29
23 0.29
24 0.29
25 0.27
26 0.26
27 0.22
28 0.22
29 0.25
30 0.3
31 0.34
32 0.34
33 0.34
34 0.3
35 0.33
36 0.33
37 0.3
38 0.24
39 0.16
40 0.15
41 0.15
42 0.14
43 0.13
44 0.12
45 0.1
46 0.1
47 0.11
48 0.09
49 0.1
50 0.1
51 0.12
52 0.13
53 0.14
54 0.14
55 0.15
56 0.15
57 0.16
58 0.18
59 0.19
60 0.21
61 0.21
62 0.21
63 0.2
64 0.21
65 0.21
66 0.18
67 0.15
68 0.14
69 0.12
70 0.12
71 0.12
72 0.1
73 0.08
74 0.08
75 0.05
76 0.04
77 0.04
78 0.04
79 0.04
80 0.04
81 0.05
82 0.05
83 0.05
84 0.07
85 0.07
86 0.12
87 0.14
88 0.17
89 0.17
90 0.19
91 0.2
92 0.19
93 0.2
94 0.18
95 0.18
96 0.15
97 0.14
98 0.13
99 0.14
100 0.16
101 0.19
102 0.17
103 0.16
104 0.16
105 0.17
106 0.16
107 0.15
108 0.14
109 0.13
110 0.14
111 0.2
112 0.25
113 0.35
114 0.41
115 0.48
116 0.55
117 0.62
118 0.72
119 0.77
120 0.82
121 0.84
122 0.88
123 0.93
124 0.95
125 0.96
126 0.96
127 0.96
128 0.95
129 0.95
130 0.95
131 0.95