Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I4Y7Z1

Protein Details
Accession I4Y7Z1    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MKVDKLKVRARKNLNPPPCGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 10.5, cyto_nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR017264  Ribosomal_MRP10_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG wse:WALSEDRAFT_48003  -  
Amino Acid Sequences MKVDKLKVRARKNLNPPPCGTELSGLLNCFASSGDYLAVSQCAQYSTSLANCMASKGRTKPKEKSTINYHLARMSKTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.77
3 0.71
4 0.67
5 0.6
6 0.52
7 0.43
8 0.34
9 0.27
10 0.27
11 0.25
12 0.2
13 0.17
14 0.15
15 0.14
16 0.12
17 0.1
18 0.07
19 0.05
20 0.06
21 0.05
22 0.05
23 0.05
24 0.05
25 0.06
26 0.05
27 0.05
28 0.05
29 0.05
30 0.06
31 0.06
32 0.07
33 0.08
34 0.08
35 0.1
36 0.09
37 0.1
38 0.1
39 0.11
40 0.13
41 0.13
42 0.17
43 0.23
44 0.33
45 0.4
46 0.47
47 0.54
48 0.62
49 0.71
50 0.7
51 0.71
52 0.7
53 0.72
54 0.73
55 0.68
56 0.6
57 0.56
58 0.54