Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I4YHH0

Protein Details
Accession I4YHH0    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
4-36VNIPKTRRTYCKGKQCRKHTPHKVTQYKKGKDSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 11, cyto 8.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG wse:WALSEDRAFT_62775  -  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MDVVNIPKTRRTYCKGKQCRKHTPHKVTQYKKGKDSIYAQGKRRYDRKQSGFGGQTKPVFHKKAKTTKKVVLRLECSVCKYKMQLSLKRCKNFELGGEKKQKGAALNF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.74
3 0.79
4 0.83
5 0.86
6 0.9
7 0.88
8 0.9
9 0.9
10 0.89
11 0.88
12 0.89
13 0.89
14 0.84
15 0.86
16 0.86
17 0.81
18 0.75
19 0.71
20 0.61
21 0.55
22 0.53
23 0.52
24 0.52
25 0.53
26 0.53
27 0.55
28 0.57
29 0.57
30 0.6
31 0.57
32 0.57
33 0.6
34 0.6
35 0.61
36 0.6
37 0.6
38 0.58
39 0.54
40 0.47
41 0.4
42 0.37
43 0.3
44 0.31
45 0.31
46 0.3
47 0.28
48 0.33
49 0.39
50 0.47
51 0.56
52 0.6
53 0.61
54 0.65
55 0.72
56 0.72
57 0.71
58 0.67
59 0.62
60 0.6
61 0.58
62 0.53
63 0.48
64 0.45
65 0.39
66 0.33
67 0.31
68 0.31
69 0.35
70 0.41
71 0.44
72 0.47
73 0.57
74 0.64
75 0.69
76 0.66
77 0.6
78 0.57
79 0.52
80 0.51
81 0.51
82 0.47
83 0.5
84 0.58
85 0.56
86 0.52
87 0.52
88 0.47