Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I4Y9Q6

Protein Details
Accession I4Y9Q6   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
4-32GQKYIIRRLAQRRKLTKLKWQRRVVKLEIHydrophilic
NLS Segment(s)
PositionSequence
14-26QRRKLTKLKWQRR
Subcellular Location(s) nucl 12, mito 10, cyto_nucl 9.5, cyto 5
Family & Domain DBs
KEGG wse:WALSEDRAFT_54942  -  
Amino Acid Sequences MFKGQKYIIRRLAQRRKLTKLKWQRRVVKLEIRRPQVQHQNLNQHLRTKHKHKHRMFLPRAPTSLQVLTTFHSDKLIEFVLYNAFVIYLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.78
3 0.79
4 0.81
5 0.78
6 0.78
7 0.78
8 0.8
9 0.8
10 0.82
11 0.83
12 0.81
13 0.83
14 0.79
15 0.77
16 0.75
17 0.74
18 0.72
19 0.68
20 0.65
21 0.61
22 0.62
23 0.61
24 0.59
25 0.56
26 0.54
27 0.57
28 0.58
29 0.6
30 0.54
31 0.49
32 0.45
33 0.45
34 0.46
35 0.46
36 0.49
37 0.54
38 0.64
39 0.63
40 0.7
41 0.71
42 0.76
43 0.74
44 0.73
45 0.7
46 0.63
47 0.6
48 0.52
49 0.46
50 0.39
51 0.33
52 0.27
53 0.21
54 0.18
55 0.18
56 0.21
57 0.2
58 0.17
59 0.17
60 0.16
61 0.15
62 0.18
63 0.18
64 0.13
65 0.12
66 0.13
67 0.13
68 0.14
69 0.13
70 0.1