Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I4Y5W8

Protein Details
Accession I4Y5W8    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
21-47EENESEGKKPQPRKKRQRQGLFRLAETHydrophilic
NLS Segment(s)
PositionSequence
28-38KKPQPRKKRQR
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR040150  Iwr1  
IPR013883  TF_Iwr1_dom  
Gene Ontology GO:0006606  P:protein import into nucleus  
KEGG wse:WALSEDRAFT_58810  -  
Pfam View protein in Pfam  
PF08574  Iwr1  
Amino Acid Sequences MSYLRIKRKRNQEPLDALLIEENESEGKKPQPRKKRQRQGLFRLAETVEQSTFTSTETKEELQARLKRKAEDDLEEDAERRHKQSLGRQIRPKPTTSRRYHVVTEDDDKKDVFIDVEQSKNESVNRSDKKDASFDPYDEDSEQMREFRKLVEDYLKMQETVTPESPTPETDKDDDYVFDVYYRDKADLRNNTQIMSNIGLLTGFYDEFGLNFDQDYSSDSTDIQDEADEDSNEEDYYTNDYPDEEVGSEEEEYPEEFVDDSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.73
3 0.62
4 0.51
5 0.42
6 0.35
7 0.25
8 0.18
9 0.14
10 0.1
11 0.11
12 0.11
13 0.13
14 0.2
15 0.27
16 0.38
17 0.47
18 0.56
19 0.67
20 0.78
21 0.86
22 0.9
23 0.93
24 0.94
25 0.95
26 0.94
27 0.93
28 0.85
29 0.74
30 0.67
31 0.56
32 0.47
33 0.38
34 0.3
35 0.2
36 0.17
37 0.17
38 0.14
39 0.14
40 0.13
41 0.14
42 0.12
43 0.15
44 0.16
45 0.17
46 0.21
47 0.23
48 0.26
49 0.31
50 0.38
51 0.41
52 0.46
53 0.49
54 0.46
55 0.46
56 0.5
57 0.45
58 0.43
59 0.42
60 0.37
61 0.37
62 0.35
63 0.33
64 0.27
65 0.28
66 0.24
67 0.22
68 0.2
69 0.2
70 0.24
71 0.32
72 0.42
73 0.47
74 0.54
75 0.61
76 0.66
77 0.73
78 0.71
79 0.66
80 0.65
81 0.64
82 0.66
83 0.64
84 0.62
85 0.57
86 0.59
87 0.57
88 0.51
89 0.45
90 0.38
91 0.39
92 0.39
93 0.35
94 0.32
95 0.29
96 0.25
97 0.22
98 0.19
99 0.13
100 0.07
101 0.11
102 0.12
103 0.14
104 0.14
105 0.15
106 0.15
107 0.16
108 0.17
109 0.13
110 0.14
111 0.22
112 0.26
113 0.29
114 0.32
115 0.32
116 0.33
117 0.34
118 0.32
119 0.3
120 0.27
121 0.23
122 0.23
123 0.22
124 0.22
125 0.19
126 0.19
127 0.13
128 0.13
129 0.13
130 0.11
131 0.11
132 0.11
133 0.11
134 0.11
135 0.14
136 0.13
137 0.15
138 0.19
139 0.19
140 0.21
141 0.25
142 0.25
143 0.22
144 0.21
145 0.21
146 0.18
147 0.21
148 0.2
149 0.17
150 0.16
151 0.19
152 0.19
153 0.18
154 0.2
155 0.18
156 0.19
157 0.19
158 0.2
159 0.19
160 0.19
161 0.18
162 0.16
163 0.15
164 0.12
165 0.11
166 0.1
167 0.1
168 0.11
169 0.12
170 0.12
171 0.13
172 0.16
173 0.24
174 0.33
175 0.38
176 0.44
177 0.44
178 0.43
179 0.43
180 0.4
181 0.34
182 0.27
183 0.21
184 0.12
185 0.12
186 0.11
187 0.09
188 0.09
189 0.08
190 0.06
191 0.05
192 0.06
193 0.06
194 0.06
195 0.09
196 0.09
197 0.08
198 0.08
199 0.08
200 0.08
201 0.08
202 0.11
203 0.12
204 0.12
205 0.13
206 0.13
207 0.13
208 0.14
209 0.14
210 0.11
211 0.09
212 0.08
213 0.11
214 0.13
215 0.12
216 0.12
217 0.13
218 0.13
219 0.13
220 0.13
221 0.1
222 0.08
223 0.15
224 0.15
225 0.15
226 0.14
227 0.15
228 0.15
229 0.16
230 0.17
231 0.11
232 0.11
233 0.11
234 0.13
235 0.13
236 0.13
237 0.12
238 0.12
239 0.12
240 0.12
241 0.11
242 0.1