Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G3AY41

Protein Details
Accession G3AY41    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
49-69FIEMFRRRWKRSKLASQNIVIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, cyto 5.5, cyto_pero 4.5, nucl 3, pero 2.5
Family & Domain DBs
KEGG cten:CANTEDRAFT_112628  -  
Amino Acid Sequences MSVRRATWSWAHIGERVDRYAGTVEHIFLPFCINDRQVCRGLSYGLKIFIEMFRRRWKRSKLASQNIVIKVCGPRARI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.32
3 0.3
4 0.26
5 0.22
6 0.22
7 0.2
8 0.18
9 0.16
10 0.13
11 0.13
12 0.14
13 0.15
14 0.13
15 0.11
16 0.12
17 0.09
18 0.1
19 0.11
20 0.1
21 0.13
22 0.15
23 0.19
24 0.2
25 0.2
26 0.19
27 0.18
28 0.18
29 0.17
30 0.16
31 0.14
32 0.13
33 0.13
34 0.12
35 0.12
36 0.13
37 0.19
38 0.2
39 0.23
40 0.32
41 0.39
42 0.44
43 0.52
44 0.58
45 0.61
46 0.69
47 0.76
48 0.77
49 0.81
50 0.82
51 0.79
52 0.79
53 0.74
54 0.65
55 0.53
56 0.45
57 0.38
58 0.38