Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3AX66

Protein Details
Accession G3AX66   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
129-148LNFLRNKKSRLKFNLSRYQLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013251  DASH_Spc19  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0042729  C:DASH complex  
GO:0005876  C:spindle microtubule  
GO:0008608  P:attachment of spindle microtubules to kinetochore  
KEGG cten:CANTEDRAFT_101074  -  
Pfam View protein in Pfam  
PF08287  DASH_Spc19  
Amino Acid Sequences MPQTPSANTNEYLLSCVSSLRASTQLLDKSIKVVDASTKDVHRLNKILKTDNVFGLVAESDLQHSIKTVQDELEPKVDALKHKYEQEVEKVRNRTNNLKNKIELQRVRLQTIRNSKGSHDVMNDKLLRLNFLRNKKSRLKFNLSRYQLEDQKNRLSAASTPQPMEEDSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.12
3 0.12
4 0.12
5 0.1
6 0.11
7 0.11
8 0.14
9 0.13
10 0.15
11 0.21
12 0.22
13 0.24
14 0.26
15 0.24
16 0.23
17 0.23
18 0.22
19 0.16
20 0.14
21 0.17
22 0.18
23 0.22
24 0.23
25 0.23
26 0.25
27 0.29
28 0.31
29 0.3
30 0.33
31 0.34
32 0.36
33 0.39
34 0.41
35 0.4
36 0.42
37 0.41
38 0.36
39 0.33
40 0.27
41 0.23
42 0.19
43 0.15
44 0.1
45 0.08
46 0.07
47 0.06
48 0.07
49 0.07
50 0.06
51 0.06
52 0.07
53 0.09
54 0.1
55 0.1
56 0.1
57 0.12
58 0.15
59 0.16
60 0.17
61 0.15
62 0.14
63 0.15
64 0.16
65 0.15
66 0.17
67 0.2
68 0.2
69 0.21
70 0.23
71 0.24
72 0.24
73 0.29
74 0.33
75 0.32
76 0.36
77 0.38
78 0.39
79 0.41
80 0.43
81 0.46
82 0.48
83 0.54
84 0.55
85 0.54
86 0.53
87 0.56
88 0.59
89 0.59
90 0.52
91 0.48
92 0.49
93 0.48
94 0.49
95 0.44
96 0.4
97 0.39
98 0.46
99 0.45
100 0.4
101 0.4
102 0.38
103 0.43
104 0.43
105 0.38
106 0.32
107 0.31
108 0.29
109 0.34
110 0.34
111 0.26
112 0.27
113 0.25
114 0.24
115 0.22
116 0.29
117 0.3
118 0.39
119 0.48
120 0.5
121 0.57
122 0.64
123 0.7
124 0.71
125 0.73
126 0.74
127 0.73
128 0.78
129 0.81
130 0.76
131 0.73
132 0.68
133 0.66
134 0.64
135 0.63
136 0.6
137 0.55
138 0.57
139 0.55
140 0.51
141 0.44
142 0.38
143 0.33
144 0.34
145 0.38
146 0.34
147 0.32
148 0.33
149 0.34