Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I4YD16

Protein Details
Accession I4YD16    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
40-63DYLTGFRKRKQKRIADRREKAVARBasic
NLS Segment(s)
PositionSequence
21-21R
45-69FRKRKQKRIADRREKAVARDKEAKK
Subcellular Location(s) nucl 18, cyto_nucl 11.833, mito_nucl 11.833, mito 4.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019186  Nucleolar_protein_12  
Gene Ontology GO:0005730  C:nucleolus  
KEGG wse:WALSEDRAFT_18109  -  
Pfam View protein in Pfam  
PF09805  Nop25  
Amino Acid Sequences MGKANNKAILSVDREAIARKRREKSKQVDELVFDEEKRRDYLTGFRKRKQKRIADRREKAVARDKEAKKQETKEVGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.24
3 0.28
4 0.33
5 0.35
6 0.42
7 0.49
8 0.57
9 0.66
10 0.72
11 0.75
12 0.77
13 0.78
14 0.75
15 0.69
16 0.61
17 0.54
18 0.48
19 0.38
20 0.28
21 0.22
22 0.18
23 0.17
24 0.16
25 0.15
26 0.12
27 0.13
28 0.21
29 0.28
30 0.38
31 0.42
32 0.47
33 0.56
34 0.62
35 0.71
36 0.72
37 0.73
38 0.73
39 0.79
40 0.85
41 0.86
42 0.86
43 0.83
44 0.83
45 0.74
46 0.68
47 0.67
48 0.61
49 0.57
50 0.61
51 0.58
52 0.59
53 0.66
54 0.67
55 0.64
56 0.65
57 0.67