Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I4YFC8

Protein Details
Accession I4YFC8    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
47-68HTSNSRSRSRSRSRVRTARAHPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 14.5, cyto 4.5
Family & Domain DBs
KEGG wse:WALSEDRAFT_59883  -  
Amino Acid Sequences MDYSSEEDSESTIEEVDAEMASMQVEHPEEAGDSVRPLRDSSRSLRHTSNSRSRSRSRSRVRTARAHPALSALWFNRAGTTVDSVEVILPDTDQREKLVDHPQTYYCLATEPPLRKVELQVGDHVSRVENDEGITVCDVVDETLNTINYIITNAAVSDDGEMDPATTLVLDGRLKRIQYVEPETLECIFEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.08
4 0.07
5 0.06
6 0.05
7 0.05
8 0.05
9 0.05
10 0.05
11 0.06
12 0.08
13 0.07
14 0.08
15 0.08
16 0.08
17 0.09
18 0.1
19 0.09
20 0.09
21 0.11
22 0.13
23 0.13
24 0.14
25 0.16
26 0.2
27 0.23
28 0.29
29 0.37
30 0.4
31 0.43
32 0.46
33 0.48
34 0.51
35 0.56
36 0.6
37 0.57
38 0.6
39 0.62
40 0.65
41 0.69
42 0.71
43 0.72
44 0.72
45 0.75
46 0.78
47 0.81
48 0.81
49 0.81
50 0.76
51 0.77
52 0.7
53 0.6
54 0.51
55 0.43
56 0.37
57 0.29
58 0.26
59 0.16
60 0.14
61 0.14
62 0.14
63 0.12
64 0.12
65 0.12
66 0.1
67 0.12
68 0.1
69 0.1
70 0.1
71 0.09
72 0.08
73 0.07
74 0.07
75 0.04
76 0.04
77 0.04
78 0.06
79 0.07
80 0.07
81 0.07
82 0.08
83 0.08
84 0.12
85 0.19
86 0.21
87 0.21
88 0.23
89 0.23
90 0.25
91 0.25
92 0.22
93 0.14
94 0.12
95 0.11
96 0.11
97 0.16
98 0.17
99 0.2
100 0.21
101 0.22
102 0.21
103 0.23
104 0.27
105 0.26
106 0.25
107 0.24
108 0.27
109 0.26
110 0.26
111 0.25
112 0.18
113 0.14
114 0.16
115 0.13
116 0.1
117 0.09
118 0.1
119 0.1
120 0.11
121 0.1
122 0.07
123 0.07
124 0.06
125 0.06
126 0.05
127 0.06
128 0.05
129 0.06
130 0.08
131 0.09
132 0.09
133 0.09
134 0.09
135 0.08
136 0.09
137 0.08
138 0.06
139 0.06
140 0.06
141 0.06
142 0.06
143 0.06
144 0.06
145 0.07
146 0.07
147 0.07
148 0.07
149 0.07
150 0.07
151 0.07
152 0.06
153 0.05
154 0.05
155 0.05
156 0.09
157 0.11
158 0.13
159 0.18
160 0.22
161 0.23
162 0.25
163 0.28
164 0.29
165 0.34
166 0.4
167 0.39
168 0.38
169 0.39
170 0.39
171 0.37