Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I4Y6L3

Protein Details
Accession I4Y6L3   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
123-142RQNARERRNRVEQELNKRKSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 15.333, cyto 4.5
Family & Domain DBs
KEGG wse:WALSEDRAFT_66239  -  
Amino Acid Sequences MTESERNATSTDTQEVSAQENERRLKDLNKSDKDTSKLLKKSEKDYKNAEKHLRDAEKAESQATKNIDKTMKEQQKAEKKKIDAEAQFNRANMFSDNAKKELDQAKELHEKRKAEFEQITTDRQNARERRNRVEQELNKRKSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.23
4 0.24
5 0.24
6 0.24
7 0.29
8 0.33
9 0.32
10 0.34
11 0.33
12 0.34
13 0.41
14 0.48
15 0.51
16 0.54
17 0.59
18 0.62
19 0.65
20 0.63
21 0.59
22 0.55
23 0.54
24 0.51
25 0.5
26 0.53
27 0.51
28 0.56
29 0.62
30 0.6
31 0.56
32 0.6
33 0.65
34 0.64
35 0.69
36 0.67
37 0.59
38 0.57
39 0.6
40 0.54
41 0.45
42 0.4
43 0.36
44 0.32
45 0.3
46 0.28
47 0.22
48 0.2
49 0.23
50 0.23
51 0.21
52 0.18
53 0.22
54 0.23
55 0.22
56 0.25
57 0.31
58 0.35
59 0.35
60 0.37
61 0.41
62 0.49
63 0.54
64 0.57
65 0.53
66 0.47
67 0.51
68 0.53
69 0.52
70 0.45
71 0.47
72 0.45
73 0.44
74 0.45
75 0.39
76 0.35
77 0.28
78 0.26
79 0.19
80 0.16
81 0.14
82 0.2
83 0.22
84 0.23
85 0.23
86 0.22
87 0.27
88 0.31
89 0.31
90 0.27
91 0.26
92 0.31
93 0.4
94 0.43
95 0.44
96 0.44
97 0.43
98 0.42
99 0.5
100 0.46
101 0.43
102 0.44
103 0.4
104 0.43
105 0.44
106 0.47
107 0.38
108 0.41
109 0.37
110 0.38
111 0.44
112 0.42
113 0.5
114 0.54
115 0.59
116 0.63
117 0.71
118 0.73
119 0.71
120 0.75
121 0.73
122 0.75
123 0.8