Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I4YF55

Protein Details
Accession I4YF55    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
13-37AGKGGAKSKKKWSKGKVKDKAQNAVHydrophilic
NLS Segment(s)
PositionSequence
10-31NPSAGKGGAKSKKKWSKGKVKD
Subcellular Location(s) nucl 16.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG wse:WALSEDRAFT_56786  -  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKKAAAAANPSAGKGGAKSKKKWSKGKVKDKAQNAVVLDRPTYDRILKEVPTFKLISQSTLIDRLKINGSLARIAIRHLHREGAIRQIVHHNGQLIYTRSGQN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.25
4 0.27
5 0.34
6 0.39
7 0.49
8 0.59
9 0.67
10 0.75
11 0.76
12 0.78
13 0.82
14 0.88
15 0.87
16 0.88
17 0.87
18 0.83
19 0.8
20 0.7
21 0.63
22 0.53
23 0.45
24 0.38
25 0.31
26 0.25
27 0.19
28 0.19
29 0.17
30 0.17
31 0.16
32 0.13
33 0.15
34 0.18
35 0.18
36 0.2
37 0.23
38 0.22
39 0.23
40 0.23
41 0.2
42 0.25
43 0.24
44 0.22
45 0.19
46 0.19
47 0.17
48 0.23
49 0.23
50 0.18
51 0.18
52 0.18
53 0.18
54 0.18
55 0.18
56 0.13
57 0.15
58 0.14
59 0.15
60 0.14
61 0.13
62 0.13
63 0.19
64 0.2
65 0.24
66 0.24
67 0.25
68 0.25
69 0.3
70 0.3
71 0.31
72 0.32
73 0.27
74 0.28
75 0.33
76 0.35
77 0.33
78 0.33
79 0.28
80 0.25
81 0.26
82 0.29
83 0.26
84 0.25