Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I4YH79

Protein Details
Accession I4YH79   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MLPRPANYSSKYRRRNPLRNLNFNLALHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 18, mito 6, E.R. 3, cyto_mito 3, mito_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007881  UNC-50  
Gene Ontology GO:0016020  C:membrane  
KEGG wse:WALSEDRAFT_59556  -  
Pfam View protein in Pfam  
PF05216  UNC-50  
Amino Acid Sequences MLPRPANYSSKYRRRNPLRNLNFNLALLQLFYLTISPRRFYRQLYYHKQTTNKWSRSDPTISIIVAGFLFISALGWSLSFKLGFSGWLKLGIKMLLIDYLAVAVLFSTLFWLLANKVLVHSPYSQSSIPSARVEWAYAFDVHTNGYFPIILLLYLLQLFLWPLLTRQEWICTFIGNTIYLVSFLHYIHITYLGYAALPFVIKSELLLTSAPLILIVYLVTLIGFNVPKATLEWYFNTSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.88
3 0.88
4 0.89
5 0.89
6 0.9
7 0.87
8 0.83
9 0.74
10 0.64
11 0.54
12 0.44
13 0.33
14 0.23
15 0.16
16 0.09
17 0.07
18 0.07
19 0.07
20 0.08
21 0.14
22 0.16
23 0.18
24 0.21
25 0.28
26 0.31
27 0.34
28 0.42
29 0.45
30 0.53
31 0.61
32 0.65
33 0.65
34 0.68
35 0.69
36 0.65
37 0.67
38 0.68
39 0.63
40 0.59
41 0.57
42 0.55
43 0.56
44 0.55
45 0.45
46 0.39
47 0.35
48 0.31
49 0.27
50 0.23
51 0.17
52 0.13
53 0.11
54 0.06
55 0.04
56 0.04
57 0.03
58 0.03
59 0.03
60 0.03
61 0.03
62 0.04
63 0.04
64 0.05
65 0.06
66 0.06
67 0.06
68 0.06
69 0.06
70 0.09
71 0.1
72 0.12
73 0.11
74 0.16
75 0.16
76 0.16
77 0.17
78 0.15
79 0.13
80 0.11
81 0.11
82 0.07
83 0.06
84 0.05
85 0.04
86 0.04
87 0.04
88 0.03
89 0.03
90 0.02
91 0.02
92 0.02
93 0.02
94 0.03
95 0.03
96 0.03
97 0.03
98 0.04
99 0.04
100 0.06
101 0.07
102 0.06
103 0.07
104 0.07
105 0.08
106 0.09
107 0.1
108 0.1
109 0.11
110 0.13
111 0.13
112 0.13
113 0.15
114 0.15
115 0.15
116 0.15
117 0.14
118 0.13
119 0.13
120 0.13
121 0.11
122 0.11
123 0.11
124 0.1
125 0.1
126 0.09
127 0.09
128 0.09
129 0.09
130 0.08
131 0.06
132 0.06
133 0.06
134 0.05
135 0.06
136 0.05
137 0.05
138 0.04
139 0.04
140 0.04
141 0.05
142 0.05
143 0.03
144 0.03
145 0.04
146 0.03
147 0.04
148 0.04
149 0.05
150 0.08
151 0.09
152 0.1
153 0.11
154 0.16
155 0.15
156 0.19
157 0.19
158 0.16
159 0.16
160 0.17
161 0.17
162 0.13
163 0.12
164 0.09
165 0.09
166 0.09
167 0.09
168 0.08
169 0.08
170 0.07
171 0.09
172 0.09
173 0.09
174 0.09
175 0.11
176 0.1
177 0.09
178 0.09
179 0.07
180 0.07
181 0.06
182 0.06
183 0.05
184 0.05
185 0.05
186 0.05
187 0.06
188 0.06
189 0.07
190 0.09
191 0.08
192 0.1
193 0.1
194 0.09
195 0.1
196 0.11
197 0.1
198 0.08
199 0.07
200 0.06
201 0.06
202 0.05
203 0.04
204 0.03
205 0.04
206 0.03
207 0.03
208 0.04
209 0.07
210 0.07
211 0.07
212 0.09
213 0.09
214 0.1
215 0.12
216 0.16
217 0.16
218 0.2
219 0.23