Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V6QSQ6

Protein Details
Accession A0A1V6QSQ6   
Localization Confidence Low
Confidence Score 5.3
NoLS Segment(s)
PositionSequenceProtein Nature
215-238VLLLWFVLRRRRQRQRSRGVQSTIHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 22, nucl 1, mito 1, cyto 1, plas 1, cyto_nucl 1, pero 1, cyto_mito 1, mito_nucl 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR036941  Rcpt_L-dom_sf  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF12454  Ecm33  
Amino Acid Sequences MIVIYLLLIANAWQRAVADSDACSSSVTISSQSDADKLSSCDTFDGSITISPSTSGVITINNVEEIKGALIAEGASELTSLLAPDLDSVEGGITLSNLNSLTTITMGALSQVSSGIIITGNPNLKTLGFQDLEKVEGQLDLAGSFDSVSLPSLDQVKGRTTIIGSSSMLCSVLDNLKSNGVFRNGYTCSSGSSGLSPGAKGGIAVGVIVAVLLIVLLLWFVLRRRRQRQRSRGVQSTIPPSSTLSTVVGPDEKAPISQGSISPQEEPLRSKEPQTLLPRKPVGSAIFLDGRSVYEVPNASTPVHEYHELDAGPVFSSHQRPMHAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.14
4 0.15
5 0.12
6 0.13
7 0.16
8 0.17
9 0.17
10 0.16
11 0.13
12 0.13
13 0.13
14 0.13
15 0.12
16 0.13
17 0.14
18 0.15
19 0.16
20 0.16
21 0.15
22 0.16
23 0.16
24 0.16
25 0.18
26 0.17
27 0.17
28 0.17
29 0.17
30 0.16
31 0.14
32 0.13
33 0.11
34 0.12
35 0.12
36 0.12
37 0.11
38 0.1
39 0.1
40 0.1
41 0.09
42 0.08
43 0.07
44 0.08
45 0.09
46 0.1
47 0.1
48 0.11
49 0.11
50 0.1
51 0.1
52 0.1
53 0.09
54 0.08
55 0.07
56 0.05
57 0.05
58 0.05
59 0.05
60 0.04
61 0.04
62 0.04
63 0.04
64 0.04
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.04
71 0.04
72 0.05
73 0.05
74 0.05
75 0.05
76 0.05
77 0.05
78 0.05
79 0.04
80 0.04
81 0.04
82 0.04
83 0.05
84 0.05
85 0.05
86 0.05
87 0.05
88 0.05
89 0.05
90 0.06
91 0.05
92 0.05
93 0.05
94 0.05
95 0.05
96 0.05
97 0.05
98 0.04
99 0.04
100 0.04
101 0.04
102 0.04
103 0.04
104 0.04
105 0.05
106 0.08
107 0.11
108 0.11
109 0.12
110 0.12
111 0.12
112 0.13
113 0.13
114 0.15
115 0.14
116 0.13
117 0.16
118 0.16
119 0.17
120 0.16
121 0.15
122 0.09
123 0.08
124 0.08
125 0.06
126 0.06
127 0.04
128 0.04
129 0.04
130 0.04
131 0.04
132 0.04
133 0.03
134 0.03
135 0.04
136 0.04
137 0.04
138 0.05
139 0.07
140 0.08
141 0.09
142 0.1
143 0.11
144 0.12
145 0.12
146 0.12
147 0.1
148 0.11
149 0.11
150 0.11
151 0.1
152 0.09
153 0.09
154 0.09
155 0.09
156 0.07
157 0.06
158 0.06
159 0.09
160 0.09
161 0.1
162 0.1
163 0.12
164 0.12
165 0.13
166 0.14
167 0.14
168 0.13
169 0.12
170 0.16
171 0.16
172 0.17
173 0.18
174 0.16
175 0.15
176 0.16
177 0.16
178 0.11
179 0.11
180 0.11
181 0.1
182 0.11
183 0.09
184 0.08
185 0.08
186 0.07
187 0.06
188 0.05
189 0.04
190 0.04
191 0.04
192 0.03
193 0.03
194 0.03
195 0.03
196 0.02
197 0.02
198 0.01
199 0.01
200 0.01
201 0.01
202 0.01
203 0.01
204 0.01
205 0.02
206 0.02
207 0.05
208 0.12
209 0.2
210 0.29
211 0.4
212 0.51
213 0.62
214 0.73
215 0.82
216 0.85
217 0.89
218 0.89
219 0.86
220 0.79
221 0.73
222 0.67
223 0.63
224 0.54
225 0.44
226 0.36
227 0.29
228 0.27
229 0.23
230 0.2
231 0.14
232 0.13
233 0.13
234 0.14
235 0.13
236 0.12
237 0.12
238 0.13
239 0.12
240 0.11
241 0.12
242 0.12
243 0.12
244 0.13
245 0.13
246 0.15
247 0.19
248 0.2
249 0.2
250 0.23
251 0.25
252 0.26
253 0.28
254 0.29
255 0.3
256 0.3
257 0.31
258 0.35
259 0.34
260 0.4
261 0.48
262 0.53
263 0.51
264 0.59
265 0.61
266 0.55
267 0.53
268 0.5
269 0.42
270 0.36
271 0.33
272 0.29
273 0.29
274 0.28
275 0.27
276 0.22
277 0.2
278 0.2
279 0.19
280 0.14
281 0.15
282 0.16
283 0.17
284 0.2
285 0.21
286 0.18
287 0.19
288 0.21
289 0.2
290 0.23
291 0.24
292 0.22
293 0.23
294 0.27
295 0.26
296 0.23
297 0.21
298 0.18
299 0.16
300 0.14
301 0.15
302 0.15
303 0.19
304 0.25
305 0.27