Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I4YGI0

Protein Details
Accession I4YGI0   
Localization Confidence Low
Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
17-38HGLCRRCNKRSWHYQKQSCASCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12.5, mito_nucl 10.666, cyto_nucl 7.833, nucl 7.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR011331  Ribosomal_L37ae/L37e  
IPR001569  Ribosomal_L37e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0005840  C:ribosome  
GO:0046872  F:metal ion binding  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG wse:WALSEDRAFT_36399  -  
Pfam View protein in Pfam  
PF01907  Ribosomal_L37e  
Amino Acid Sequences MTKGTTSMGKRQSVKSHGLCRRCNKRSWHYQKQSCASCGFPLAKTRTAFSSFHFNWGAKAKRRTTTGTGRMRSLKYVSRRFKNGFREGTVAKKAPASA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.59
3 0.62
4 0.63
5 0.67
6 0.69
7 0.71
8 0.77
9 0.73
10 0.73
11 0.72
12 0.73
13 0.76
14 0.79
15 0.8
16 0.79
17 0.81
18 0.83
19 0.81
20 0.75
21 0.66
22 0.58
23 0.47
24 0.37
25 0.33
26 0.27
27 0.2
28 0.22
29 0.23
30 0.26
31 0.25
32 0.25
33 0.25
34 0.26
35 0.26
36 0.21
37 0.28
38 0.23
39 0.26
40 0.27
41 0.24
42 0.23
43 0.3
44 0.34
45 0.32
46 0.39
47 0.39
48 0.42
49 0.45
50 0.48
51 0.48
52 0.52
53 0.54
54 0.57
55 0.55
56 0.54
57 0.56
58 0.53
59 0.49
60 0.43
61 0.41
62 0.41
63 0.49
64 0.55
65 0.57
66 0.63
67 0.66
68 0.7
69 0.72
70 0.72
71 0.67
72 0.61
73 0.6
74 0.55
75 0.57
76 0.56
77 0.48
78 0.4